KEGG   Streptomyces pluripotens: LK06_002080Help
Entry
LK06_002080       CDS       T04845                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
splu  Streptomyces pluripotens
Pathway
splu00020  Citrate cycle (TCA cycle)
splu00480  Glutathione metabolism
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
splu01120  Microbial metabolism in diverse environments
splu01130  Biosynthesis of antibiotics
splu01200  Carbon metabolism
splu01210  2-Oxocarboxylic acid metabolism
splu01230  Biosynthesis of amino acids
Module
splu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
splu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:splu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LK06_002080
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LK06_002080
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LK06_002080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: ARP68937
UniProt: A0A221NUI4
LinkDB All DBs
Position
497504..499723
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTYTDEAPALATHSFLPVIQAYASQAGVPVKTRDISLAGRIIAVFPEYLNEDQ
RIADALTELGNLAKTPAANIVKLPNISASIPQLKAAIAELQGKGYALPDYPDDPKSDEER
EIRARYDKIKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTPESRTNVATMGEND
FRSTEKSAVIAEDGTLRIELVGEDGTTTVLRESVPVLKDEVVDAAVLRTAELNTFLAAQV
ARAKEEGVLFSVHLKATMMKVSDPIIFGHVVRSFFPKTFAKYAGTLTAAGLTPNDGLGVI
LKGLDGLPEGAEIKASFEAELAEGPDLAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGADGQEHDTLAVIPDSSYAGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPAAGTVRLVDQAGNVVLEQPVAEGDIFRSCQAKDAPIRDWVKLAVTRARATGD
PAVFWLDENRAHDAQLIAKVKQYLLDHDTEGLDIRILAPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPAFEQFAETTGNARAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAQQTDDADLAKAFAPFAETLAANEQKIVDELIAVQGSPAEIGGYYKVDKAK
ADAVMRPSATWNETLASLR
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacctacacagacgaggccccggccctggcgacgcat
tcgttcctgccggtgatccaggcgtacgcctcgcaagccggtgtacccgtgaagacccgc
gacatctcgctggccgggcgcatcatcgccgtcttcccggagtacctgaacgaggaccag
cgcatcgccgacgcgctgaccgagctgggcaacctggccaagacgcccgcggccaacatc
gtcaagctgccgaacatctcggcgtcgatcccgcagctgaaggccgcgatcgcagagctg
cagggcaagggctacgcgctgccggactacccggacgacccgaagtccgacgaggagcgt
gagatccgcgcccgctacgacaagatcaagggctccgccgtcaacccggtgctccgtgag
ggcaactccgaccgccgtgctcccgcctcggtgaagaactacgccaagacccacccgcac
cgcatgggtgcctggacccccgagtccaggacgaacgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgcggtgatcgccgaggacggcacgctgcggatcgagctg
gtgggcgaggacggcaccaccaccgtgctgcgcgagtccgtgcccgtcctcaaggacgag
gtcgtcgacgccgcggtcctgcgcaccgccgagctgaacactttcctcgccgcgcaggtc
gcccgcgccaaggaggagggcgtcctgttctccgtgcatctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtgcgctccttcttcccgaagacgttcgcg
aagtacgcgggtaccctcacggcggcgggcctgaccccgaacgacggcctgggcgtcatc
ctcaagggcctggacggcctgcccgagggcgccgagatcaaggcctccttcgaggccgag
ctggccgagggtccggacctcgccatggtcgactcggacaagggcatcaccaacctgcac
gtcccctcggacgtcatcgtcgacgcctccatgccggcgatgatccgcacgtcgggccac
atgtggggggcggacggccaggagcacgacaccctcgcggtcatccccgactcctcgtac
gccggtgtctaccaggccgtcatcgaggactgccgggccaacggcgcctacgacccgtcc
accatgggctcggtgccgaacgtggggctgatggcgcagaaggccgaggagtacggctcc
cacgacaagaccttcgagatcccggcggcaggcaccgtccgcctggtcgaccaggccggc
aacgtcgtcctggagcagccggtcgccgagggcgacatcttccgctcctgccaggcaaag
gacgccccgatccgcgactgggtcaagctggccgtcacccgcgcccgtgccaccggcgac
ccggcggtgttctggctggacgagaaccgtgcgcacgacgcacagctcatcgccaaggtc
aagcagtacctgctggaccacgacaccgagggcctggacatcaggatcctcgccccggtc
gaggccaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctccgtcacc
ggcaacgtcctgcgcgactacctgaccgacctcttccccatccttgaactgggcaccagc
gccaagatgctgtcggtcgtgccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggctccgcgccgaagcacgtccagcagttggtcaaggagaactacctgcgctgggac
tccctgggcgagttcttcgccctggtgccggccttcgagcagttcgccgagaccaccggc
aatgcccgtgccaaggtcctcgccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtcaccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcccagcagaccgacgacgccgacctggccaag
gccttcgcgccgttcgccgagacgctcgcggcgaacgagcagaagatcgtggacgagctg
atcgccgtccagggctccccggccgagatcggcggttactacaaggtcgacaaggccaag
gcggacgcggtcatgcgcccgtcggccacctggaacgagacgctggcctccttgcgctaa

DBGET integrated database retrieval system