KEGG   Streptomyces pluripotens: LK06_003140Help
Entry
LK06_003140       CDS       T04845                                 

Definition
(GenBank) peptide-binding protein
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
splu  Streptomyces pluripotens
Pathway
splu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:splu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LK06_003140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_003140
Transporters [BR:splu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    LK06_003140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: ARP69107
UniProt: A0A221NTS2
LinkDB All DBs
Position
complement(735571..737148)
Genome map
AA seq 525 aa AA seqDB search
MFNRNRFLRRVAAIASISLVAGCSLLSDGSPDNKGPIIVGTTSAPSTLDPAGAYDGSWEL
YRNIYQTLLAYPNGATTPQPDAAQSCSFTDSTSRTYRCTLREGLKFADGAPLTAEAVQHS
IDRIRTINAPSGPAGLLGSLDRIQTSGDREIVFHLNKPDATFPFVLATPAMSIVDPDDYP
ANSLRKDNKVFGSGPYKIKSYDEGKQVTLVANKNYKGFAKLQNDAVTIRYFQNSSSMVKA
LRAKQIDVTYRGLAADDILALQQHGSSDLELIDGAGVDISYLVFNPKDPWAGRPAVRKAI
AQIVNRSAIAHKVYKDTVDPLYSMVPTGLTGHTTGFFDDYGNPSVPKARKILTDAGITQP
VPLTFWYTTDRYGSETALMFQELKRQLEASGLFTITIKGRPWKTYVVGYQKGEYPVFGRG
WFPDFPDADNFIAPFVGEHNALGTPYPSKEITDKLLPHSRAESDRAQTVKDMEQAQQILV
NDARLIPLWQGRQYIAASEDISGGEQSLDPSTIMMMWTLHRKTSW
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaaccggaaccgattcctgcggagagtcgcggcgatcgcgtccatatccctggtt
gcgggttgcagtctgctgtccgacggcagtcccgacaacaaggggcccatcatcgtggga
accaccagtgcccccagcacgctggaccccgccggtgcctatgacggttcctgggagctg
taccggaacatctaccagacgctcctcgcctaccccaacggcgccaccaccccccaacct
gacgctgcccagagctgctccttcaccgactcgacgagccgaacctaccgctgcacgctg
cgcgagggcctgaagttcgccgacggcgcacccctgacggcggaggccgtccagcactcc
atcgaccggatccgcaccatcaacgcgcccagcgggcccgccggactgctgggcagcctg
gaccgtatccagacgtccggtgaccgcgagatcgtcttccatctcaacaagcccgacgcc
accttcccgttcgtgctggccacgcccgccatgtcgatcgtcgacccggacgactacccg
gccaactcgctgcgcaaggacaacaaggtcttcggctccggaccatacaagatcaagtcg
tacgacgagggcaagcaggtcaccctggtggccaacaagaactacaagggtttcgccaag
ctgcagaacgacgcggtcaccatccgctacttccagaactcgtccagcatggttaaggcg
ttgcgggccaagcagatcgacgtcacctaccgcggtctcgcagccgacgacatcctggcc
ctgcagcagcacggcagctccgacctggaactgatcgacggcgccggcgtcgacatcagc
tacctggtgttcaaccccaaggacccctgggctggacggcccgccgtgcgcaaggccatc
gcgcagatcgtcaaccggagtgcgatcgcgcacaaggtctacaaggacaccgtcgatccg
ttgtactccatggtccccaccggtctgaccggccacaccaccggcttcttcgacgactac
ggcaacccgagcgtccccaaggcccgcaagatcctcaccgacgcgggcatcacccagccc
gtcccgctcaccttctggtacaccaccgaccgctacggctccgagacggccctgatgttc
caggagctgaagcggcagctggaggcctccggcctgttcaccatcacgatcaagggacgc
ccctggaagacctacgtggtcgggtaccagaagggtgagtacccggtgttcggccgcggc
tggttcccggacttccccgacgcggacaacttcatcgcccccttcgtcggcgagcacaac
gcgctgggcacgccctacccgtccaaggagatcacggacaagctgctgccccactcgcgt
gcggagagcgatcgcgcccagaccgtgaaggacatggaacaggcgcagcagatcctggtg
aacgacgcccggctgatcccgttgtggcaaggacggcagtacatcgcggccagcgaggac
atttccggcggggagcagtccctcgacccgtccacgatcatgatgatgtggacgctgcac
cgcaagaccagctggtga

DBGET integrated database retrieval system