KEGG   Streptomyces pluripotens: LK06_006550Help
Entry
LK06_006550       CDS       T04845                                 

Definition
(GenBank) ABC transporter permease
  KO
K10233  alpha-glucoside transport system permease protein
Organism
splu  Streptomyces pluripotens
Pathway
splu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:splu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LK06_006550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_006550
Transporters [BR:splu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   alpha-Glucoside transporter
    LK06_006550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 CarboxypepD_reg SdrD_B SpaA DUF2012 CarbopepD_reg_2
Motif
Other DBs
NCBI-ProteinID: ARP69667
UniProt: A0A221NV93
LinkDB All DBs
Position
complement(1481934..1483283)
Genome map
AA seq 449 aa AA seqDB search
MTATLVKRQAGPRAAGAARGRRGRRRAWLVAVFFVLPALLLLGALVVYPVLFSVGRSFFD
ASGTRFVGGDNYTEMFRDPATLKAIRNTAIWVVVAPALLTGLGLILAVLVEKIRWATAFK
LLLFMPMAVSFLAAGIIFRLAYDQDPDKGVLNAAVVSVHDAFTGTSTYPTARGRQGLLVH
DRDGSYRTTGSTGDTVNLAMVGVLPKDLPKGAAPAYPAATAKPAPGQLGGVVYLDFTPGG
GGEQGRVDRGESGLPGMKVEAVRGGKTVASTTTAPDGSFRFTGLADGSYTVKLPASNFAP
PYQGVSWLGPALVTPAIIGAYLWIWTGFAMVLISAGLSTLPRDALEAARIDGANEWQIFR
RITVPLLAPVLTVVFVTLVINVMKVFDLVYIIAPGPVQEDATVLATQMWLVSFGGGNNQG
LGSALGVLLLLLVVPAMVFNVRRFRRSQR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacacttgtgaaacgacaggcgggcccgcgggccgccggcgcggcgcgcggg
cgccgcggccggcggcgcgcctggctggtcgccgtgttcttcgtccttcccgcgctgctc
ctgctcggcgcgctcgtcgtctacccggtgctgttctcggtcggccggagcttcttcgac
gcctccggcacccggttcgtcggtggtgacaactacaccgagatgttccgggacccggcc
acactgaaagccatccggaacaccgccatctgggtggtcgtggccccggcactgctcacc
ggcctcggcctgatcctggctgtcctggtggagaagatccgctgggccaccgccttcaaa
ctactgctgttcatgccgatggcggtgtctttccttgccgccggcatcatcttccggctc
gcctacgaccaggacccggacaagggcgtgctcaatgcggccgtcgtctccgtccacgat
gcgttcacggggacctcgacgtacccgacggcccgcgggcgtcagggactgctcgtccat
gaccgggacggctcctaccgcacgaccggctccacgggcgacacggtgaacctggccatg
gtcggggtcctgcccaaggacctgcccaagggcgccgctcccgcatatccggccgccacc
gcgaagccggcccccggccaactgggcggggtggtctacctggacttcacccccggcggg
ggaggggaacagggcagggtcgaccgcggggaaagcggactgcccggcatgaaggtcgag
gccgtgcggggcggaaagacggtcgcgagcaccacgaccgcccccgacggctccttccgc
ttcaccgggctcgccgacggctcctacacggtgaagctgcccgcctccaacttcgccccg
ccctaccagggcgtctcctggctcggcccggcactcgtcacgccggcgatcatcggcgcc
tacctgtggatctggacgggcttcgcgatggtgctgatcagcgcggggctctccaccctt
ccgcgcgacgcgctggaggccgcccggatcgacggcgcgaacgagtggcagatcttccgc
cgcatcaccgtcccgctgctcgcgcccgtgctcaccgtggtcttcgtgaccctggtgatc
aacgtgatgaaggtcttcgacctcgtctacatcatcgcccccggaccggtgcaggaggac
gccacggtcctagcgacccagatgtggctggtgtccttcggcggcggtaacaaccagggc
ctcggcagtgccctcggcgtgctcctgctgcttctggtggtccccgcgatggtgttcaac
gtccgccgcttccgaaggagtcagcgatga

DBGET integrated database retrieval system