KEGG   Streptomyces pluripotens: LK06_006900Help
Entry
LK06_006900       CDS       T04845                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
splu  Streptomyces pluripotens
Pathway
splu02010  ABC transporters
splu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:splu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LK06_006900
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LK06_006900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_006900
Transporters [BR:splu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    LK06_006900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 BCA_ABC_TP_C AAA_23 AAA_29 AAA_27 MMR_HSR1 RsgA_GTPase AAA_24 SURF2
Motif
Other DBs
NCBI-ProteinID: ARP69721
UniProt: A0A221NVI7
LinkDB All DBs
Position
1566211..1567188
Genome map
AA seq 325 aa AA seqDB search
MTTPVLEARDVTMRFGGLTAVRSVDFTVNSGEIVGLIGPNGAGKTTFFNCLTGLYIPTEG
TVAYRGKVLPPKPHLVTQAGIARTFQNIRLFANMTVLENVLVGRHTRTKEGLWSALLRGP
GFRNAEKRSETKAMELLEFVGLDAKRDHLARNLPYGEQRKLEIARALASEPGLLLLDEPT
AGMNPQETRATEDLVFAIRDMGIAVLVIEHDMRFIFNLCDRVAVLVQGEKLVEGTSDVVQ
ADERVVAAYLGEPFEGDSGEAEAGEGEASRTEPAKADAAQAEPAQADASEDETSDDETSD
DEAAEAAETEPAAEESTRTTQGETP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacctgtactcgaagcccgtgacgtcacgatgcgcttcggcggcctgaccgcc
gtccggtcagtcgacttcacggtcaacagtggcgagatcgtcggcctgatcggcccgaac
ggcgccggcaagaccaccttcttcaactgcctcaccggcctgtacatacccaccgagggc
acggtcgcctaccggggcaaggtcctgccgcccaagccgcacctggtgacccaggcgggc
atcgcccgcaccttccagaacattcggctcttcgccaacatgaccgttctggagaacgtc
ctcgtgggccgccacacacggaccaaggaaggcttgtggtcggcgctgctgcgcggtccg
ggcttccgcaacgccgagaagcggtccgagaccaaggccatggaactcctggagttcgtc
ggcctggacgcgaagcgggaccacctcgcgcggaacctgccctacggcgagcaacgcaag
ctggagatcgcccgggcactggcgagcgagcctggcctgctgctgctcgacgaaccgacc
gccggcatgaacccgcaggaaacccgggccaccgaagacctcgtcttcgccatccgggac
atgggcatcgccgtcctggtcatcgagcacgacatgcgcttcatcttcaacctgtgcgac
cgtgtggccgtcctggtccagggcgagaagctcgtcgagggcacctccgacgtcgtccag
gccgacgagcgcgttgtcgccgcctacctgggagagcccttcgaaggcgactcaggggag
gcggaggccggggagggcgaggcctcacggaccgaacccgccaaggccgacgccgcacag
gcggaacccgcgcaagccgacgcctcagaggacgaaacctcggacgacgaaacctcggac
gacgaggccgcagaagccgccgagaccgaaccggccgccgaggagagcacccgcaccacc
cagggagagaccccgtga

DBGET integrated database retrieval system