KEGG   Streptomyces pluripotens: LK06_008545Help
Entry
LK06_008545       CDS       T04845                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ARP70005
UniProt: A0A221NWH1
LinkDB All DBs
Position
complement(1929668..1931119)
Genome map
AA seq 483 aa AA seqDB search
MTELVEHEHLFIGGELIEPRGKDVIEVVSPHTEEVIGRVPHASREDVDRAVAVARRAFDE
GPWPRTSLEERIEIVTRIKDGIAARHEEIARVISAENGSPYSWSVLAQALGAMMVWDAAI
RVARDFTCEERRDGVLGPLLVRREPVGVVAAVVPWNVPQFVAAAKLAPALLTGCTAVLKP
SPESPLDAYLLGEIAREAGLPEGVLSILPADREVSEYLVGHRGVDKISFTGSAPAGRRVM
EVAARNLTRVTLELGGKSAALVLPDADVATAVSGIVPAAWMNNGQACVAQTRILVPRTRY
DEFADAFAQAANALKVGDPLDPATQVGPLVARRQQQRSLDYIRVGQEEGAKVLAGGGRPA
GIERGWYVEPTLFGDVDNSMRIAREEIFGPVICLLPYGDESEAVKIADDSDYGLSGSVWT
ADTEHGIEIARRVRTGTYCVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEYLEHKMIHLP
AGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgtggaacacgaacacctgttcattggcggggagttgatcgaaccccga
ggcaaggacgtcatcgaggtggtctccccgcacaccgaggaggtcatcggacgggtgccg
cacgcctcccgggaggacgtcgaccgggcggtggccgtcgcgcgccgcgccttcgacgag
ggtccctggccgcgcacctcgctggaggagcggatcgagatcgtcacccgcatcaaggac
ggcatcgccgcccggcacgaggagatcgcccgggtgatctccgccgagaacggctccccg
tactcctggagcgtcctcgcccaggcgctcggcgcgatgatggtgtgggacgcggcgatc
agggtggcgcgggacttcacctgcgaggagcgccgcgacggtgttcttggcccgctcctc
gtgcgccgcgaacccgtcggtgtggtcgcggccgtcgtcccttggaacgtcccgcagttc
gtggccgccgccaagctcgctcccgcgctgctgaccggctgcacggccgtactgaaaccg
tccccggagtccccgctggacgcctacctcctcggcgagatcgcccgcgaggccggcctg
ccggagggggttctctccatcctccccgccgaccgggaggtcagcgagtacctggtcggc
caccggggagtcgacaagatctcctttaccggttcggccccggccggcaggcgcgtgatg
gaggtggccgcgcgcaacctcacccgggtgacgctggagttgggcggcaagtcggcggcg
ctcgtgctcccggacgctgacgtggcgacggctgtgtccgggatcgtcccggcggcctgg
atgaacaacggacaggcctgcgtggcccagacccgcatccttgtcccgcgcacccgctac
gacgagttcgccgacgccttcgcgcaggccgcgaatgcgctgaaggtcggcgatccactg
gaccccgctacccaggtgggcccactggtcgcccgccgtcagcagcagcgcagcctcgac
tacatccgcgtcggccaggaagagggcgccaaggtcctggccggtggcggccgtccagcg
ggcatcgagcggggctggtacgtcgagccgaccctcttcggtgacgtcgacaactcgatg
cggatcgcccgtgaggagatcttcggtccggtgatctgccttctgccgtacggcgacgag
tccgaggccgtgaagatcgccgacgactccgactacggcctgtccggcagcgtctggacc
gcggacaccgagcacgggatcgagatcgcccggcgggtccgtaccggcacctactgcgtc
aacaccttcagcctggacatgctcggcccgttcggcggctacaagaactccgggctgggt
cgggagttcggtcccgagggctacggcgaatacctggagcacaagatgatccacctgccg
gcgggggcatag

DBGET integrated database retrieval system