KEGG   Streptomyces pluripotens: LK06_008785Help
Entry
LK06_008785       CDS       T04845                                 

Definition
(GenBank) ion transporter
  KO
K10716  voltage-gated potassium channel
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_008785
Transporters [BR:splu02000]
 Other transporters
  Pores ion channels [TC:1]
   LK06_008785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ion_trans_2 Ion_trans Lig_chan
Motif
Other DBs
NCBI-ProteinID: ARP70045
UniProt: A0A221NWL5
LinkDB All DBs
Position
1985049..1985792
Genome map
AA seq 247 aa AA seqDB search
MERLSPQARWERYSERPLLALTVAFTVAYAVPIVDGSAGYSLTAMCTVVEWVVWGAFAVD
YVIRLALAPRRGEFVRRHWPDLCAVVLPILQPLRLLRLVSTLLLVGRRARMAPQIRLTTY
VVGSVVGLLMFGSLAVLSVERDSPRGNIRTLGDAVWWSFTTMTTVGYGDHAPTTGLGRMI
AVGLMLSGIALLGVVTANIAAWFISRFEKDDVEERRQTEAIASLVEEVRLLRVEVARLAA
QREEQRP
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggagcgactttcgccgcaggcgcgctgggaacggtactccgaacgacccctgctggca
ctgacggtggcgttcaccgtcgcgtacgcagtgccgatcgtggacggttccgcgggatac
tcactgaccgccatgtgcaccgtcgtggagtgggtggtgtggggggcgttcgccgtggac
tacgtgatacggctggcgctggcaccccggcgcggtgagttcgtccggcggcactggccc
gacctgtgcgccgtggtgctgccgatcctccagccactgcggctgttgcgcctggtgtcg
acgctgctgctggtgggacggcgagcgcggatggcaccgcagattcgactgaccacctat
gtcgtcggttccgtggtcgggctgctgatgttcggctcgctcgcggtgctgtccgtggaa
cgggattcaccgagggggaacatccggacgctgggtgatgcggtgtggtggtcatttacg
acgatgacgaccgtcggatacggggatcacgcgccgacgaccggccttggccggatgatc
gccgtcggcctgatgctgtccggtatcgcactgctgggcgtggtgacagcgaacatcgcc
gcgtggttcatctcccggttcgagaaggacgacgtggaggagaggcgccagacggaggca
atcgcctctctggtcgaggaggttcggctcctgcgggtggaagtggcccgactggcggcc
cagcgggaggagcaacggccctga

DBGET integrated database retrieval system