KEGG   Streptomyces pluripotens: LK06_010390Help
Entry
LK06_010390       CDS       T04845                                 

Definition
(GenBank) ABC transporter permease
  KO
K01992  ABC-2 type transport system permease protein
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_010390
Transporters [BR:splu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LK06_010390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_4 ABC2_membrane_3
Motif
Other DBs
NCBI-ProteinID: ARP70309
UniProt: A0A221NXB8
LinkDB All DBs
Position
complement(2348073..2348936)
Genome map
AA seq 287 aa AA seqDB search
MSTFAERTGAVSGYRAGRTLPLRVELVRQLKRRRTLVMGAILAALPFVLLIAFAVGGDPG
GRNNRITLMDTATASGANFAAVNLFVSAGFLLVIPVALFCGDTVASEAGWSSLRYLLAAP
VPRARLLLSKLAVALGLSLAAMLLLPVVALAVGTAAYGWGPLQIPTGGALDTATAAQRLA
LTVAYIFVSQLVTAGLAFWLSTKTDAPLGAVGGAVGLTIVGNVLDAVTALGHWRNFLPAH
WQFAWADAVQPHPEWSGMIQGTALSLTYALVLFALAFRGFARKDIVS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcgccgaacgcaccggggcggtgtccggctaccgcgcgggccgcaccctg
cccctgcgcgtggagctggtgcgccagctcaagcggcgccgcaccctggtcatgggggcg
atcctcgccgccctgccgttcgtgctgctgatcgccttcgccgtgggcggcgaccccggc
ggccggaacaaccggatcaccctgatggacacggccaccgcgtccggcgccaacttcgcc
gcggtgaacctgttcgtctcggccggtttcctgctcgtcatcccggtcgccctgttctgc
ggggacacggtcgcctcggaggccggctggtcctccctgcgctacctgctcgccgcacct
gtgccccgcgcccggctgctgctgtccaagctcgccgtggcactcgggctgagcctggcc
gcgatgttgctgctgccggtggtggccctcgccgtcggcacggccgcctacggctggggc
ccgttgcagatccccaccgggggcgcactggacaccgctacggcggcacagcggctcgcg
ctgacggtggcgtacatcttcgtctcccaactggtcaccgcagggctggcgttctggctg
tcgaccaagacggacgcgccgttgggagcggtcggcggcgcggtaggcctgaccatcgtc
ggcaacgtgctggacgccgtcaccgccctcggacactggcggaacttcctgcccgcccat
tggcagttcgcctgggccgacgccgtccagccacaccccgagtggtccggcatgatccag
ggcaccgcactgtccctcacgtacgccctcgtgttgttcgcgctggccttccggggattc
gcgcgcaaggacatcgtctcctag

DBGET integrated database retrieval system