KEGG   Streptomyces pluripotens: LK06_011575Help
Entry
LK06_011575       CDS       T04845                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ARP70498
UniProt: A0A221NXW0
LinkDB All DBs
Position
complement(2610404..2612191)
Genome map
AA seq 595 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARMGVPPGTQPVGTPWGSETGGAGATAPGGTGETVA
IKVLKEELASDPDIVMRFLRERSVLLRLTHPNIVQVRDLVVEGDLLALVMDLVDGPDLHR
YLRENGPLTPVAAALLTAQIADALAASHADGVVHRDLKPANVLLRQQDGQMHPMLTDFGI
ARLADSPGLTRTHEFVGTPAYVAPESAEGRPQTSAVDVYGAGILLYELATGRPPFSGGTA
LEVLHQHLSAEPRRPSTVPDPLWTVIERCLRKNPDERPSAVNLARGLRVVAEGVGVHANA
AQIAAAEGVGALLAPDPAPTAAPGAADPTQVLPANAPQGAYDPNAATSFLPHAGGPAGAA
DSTAVLPSTGAADPTAVLPPVPPDQQGYPGQPGQQGTQGQQPEQPHPWQNQLRAARDRNE
QTQIQYLDPDEDPLRRRPQRQVARPQQQPTQAPRAGSQQPPSRGRQRPPAGYAPQQQPQQ
YAPQQYAAPQQQPQQYAPQQPQRYAPPAQPEPQRPAREPRPPRQRSANPMKIPGLGCLKG
CLFTIVILIVAGWLIWDLTPLHTWVGQGRGYWNQLSDWAGKVSQWAKDLGNSLGN
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccagtcggcagcaaatacctgcttgaggagccgctcggacgcggcgccacaggc
accgtctggcgtgcccgcatgggggtcccccctggcacgcagcctgtcggaactccctgg
gggagcgagaccggcggagccggtgcgaccgcgcccggtgggaccggagagaccgtcgcg
atcaaggtcctcaaggaggaactggcgagcgaccccgacatcgtgatgcgctttctgcgt
gagcgctccgtgctgctccgcctcacccatccgaacatcgtccaggtccgtgacctggta
gtcgagggtgatctgctggcgctggtcatggatcttgtcgacggccccgacctgcaccgc
tacctgcgcgagaacggccccctcaccccggttgccgccgccctgctgaccgcgcagatc
gccgacgcgctcgccgcgagccatgccgacggcgttgtccaccgcgatctgaagccggcc
aacgtcctgctgaggcagcaggacggtcagatgcatccgatgctgaccgacttcggcatc
gcccgcctcgccgactccccggggctcacccgtacccatgagttcgtgggtacgcctgcg
tacgtggcaccggagtccgccgagggccgcccgcagacctccgccgtcgacgtctacggc
gccggcatcctcctgtacgagctggccaccggccgcccgccgttctccggcggcaccgct
ctggaggtgctccaccagcacctcagcgccgagccgcgacgtccttccacggttccggac
ccgctgtggacggtcatagaacgctgtctgcgcaagaacccggacgagcggccgagcgct
gtgaacctcgcgcgcgggttgcgggtcgtcgccgagggcgtcggcgtccacgcgaatgcc
gcccagatcgccgctgccgagggcgtcggcgccctgctcgccccggacccggccccgacc
gccgcccccggcgccgccgaccccacccaggtgctgccggcgaacgcgccccagggggcg
tacgacccgaacgccgccaccagtttcctgccgcacgccggtggcccggccggcgcggcg
gactccaccgccgtgctgccgagcaccggagccgccgacccgacggccgtcctgccgccg
gtgcccccggaccagcaggggtacccggggcagcctggccagcagggaacgcaggggcag
cagcccgagcagccacatccttggcagaaccagctgcgcgccgcgcgcgaccgtaacgag
cagacgcagatccaatacctcgacccggacgaggacccgctgcgccgccgcccccagcgg
caggtggcccggcctcagcagcagccgacccaggccccgcgggccggctcgcagcagccc
ccgtcgcgcggtcggcagcgcccgccggcgggctacgccccgcagcagcaacctcagcag
tacgccccgcagcagtacgccgccccgcagcagcaacctcagcagtacgctccccagcag
ccccagcggtacgcgccccccgcgcaaccggagccgcagcggcccgcgcgcgagccccgc
ccgcccaggcagcgcagcgccaacccgatgaagatccccgggctcggctgtctcaagggc
tgcctgttcacgatcgtcatcctgatcgtggcgggctggctgatctgggacctcaccccg
ctgcacacctgggtcggacagggcaggggctactggaaccagctgagcgactgggccggg
aaagtgagccaatgggccaaagatctgggcaattccctgggtaactga

DBGET integrated database retrieval system