KEGG   Streptomyces pluripotens: LK06_014300Help
Entry
LK06_014300       CDS       T04845                                 

Definition
(GenBank) antibiotic resistance protein MarC
  KO
K05595  multiple antibiotic resistance protein
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_014300
Transporters [BR:splu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   LK06_014300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarC
Motif
Other DBs
NCBI-ProteinID: ARP70930
UniProt: A0A221P090
LinkDB All DBs
Position
3208483..3209115
Genome map
AA seq 210 aa AA seqDB search
MSTLELTVQATIAMILLVDPFIRAIFFRLMTEHEPERRREYVRRIMLTVTIALGGAALVG
REVLDLIGIDLGAFGLAGGLVLALMGFEMLFGGQQPRAQGGASAHAEPALESAEGSIVVP
YAIPFMAGPGAITTVITIASTGSGWSGPVAALIAVGITVALIPVGHLLLVNKMNMTPQTM
SIMTRFGGLFVATIGVQLMLGGIKSYFGIT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacttgagctgacggtgcaggcgaccatcgccatgatcctgctggtcgatccg
ttcatccgcgccatcttcttccgcctgatgaccgagcacgagcccgaacggcgacgcgag
tacgtccgtcgcatcatgctgaccgttacgatcgccctgggtggtgcggcgctcgtcggc
cgagaggtgctcgatctcatcggcatcgacctcggagccttcggcctggcaggcggactc
gtactcgccctgatggggttcgagatgctcttcggcggccagcagcctcgtgcgcagggg
ggtgcctcggctcatgcggaaccggcgctggagtcggccgagggctcgatcgtcgtgccg
tacgccatccccttcatggcgggcccgggcgcgatcaccacggtgatcaccatcgcctct
accggaagtggatggtccggacccgtcgccgcgctcatcgccgtgggcatcacggtggcc
ctgatccccgtgggacacctgctgctggtcaacaagatgaacatgacaccgcagaccatg
tccatcatgacgcgtttcggcgggctgttcgtcgccacgatcggtgtccagctcatgctc
ggcgggatcaagtcgtacttcggcatcacatga

DBGET integrated database retrieval system