KEGG   Streptomyces pluripotens: LK06_019735Help
Entry
LK06_019735       CDS       T04845                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
splu  Streptomyces pluripotens
Pathway
splu00620  Pyruvate metabolism
splu00680  Methane metabolism
splu01100  Metabolic pathways
splu01120  Microbial metabolism in diverse environments
splu01200  Carbon metabolism
Module
splu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LK06_019735
  09102 Energy metabolism
   00680 Methane metabolism
    LK06_019735
Enzymes [BR:splu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LK06_019735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARP71810
UniProt: A0A221P1B9
LinkDB All DBs
Position
4359042..4361786
Genome map
AA seq 914 aa AA seqDB search
MSSADDQTTTTSSELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAELL
RGTELETAAKLVRAFSTYFHLANITEQVHRGRELRARRAAEGGLLARTADRLKDADPEHL
RQSVQNLNVRPVFTAHPTEAARRSVLNKLRRIAALLDTPVLPSDRRRHDVRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHADAVGDVLEDLTAELERVGVTVPDATRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALETIDELRGLLSHSIRYTGATEELLDSL
KADLERLPEISPRYKRLNAEEPYRLKATCIRQKLANTKQRLATGTPHEEGRDYLGTGQLL
KDLRIIQASLREHRGGLFADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPREYRAKLLAKELRSRRPLAPTPAPVDAPGTKTLGVFETVKKALETFGPE
VIESYIISMCQGADDVFAAAVLAREAGLVDLHAGWARIGIVPLLETTDELRAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHGAYRRLVEDPDLPAYFFASTPVDQLAEL
HLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLRYEGDTV
LDEMHQQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIKAEHELTVREV
LRVTGENELLDAQPVLRQTFGIRDAYLDPISYLQVTLLKRQRDAADAGATPDPLLSRALL
LTVNGVAAGLRNTG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgaccagcagcgagctgcgtgccgacatccgc
cggctgggtgacctcctgggcgagaccctcgtccggcaggaaggccccgaactcctcgac
ctggtggaaaaggtccgccgcctgacccgtgaggacggcgaggccgccgccgagctgctg
cgcggcaccgaactggagaccgcggccaagctggtccgcgccttctccacctacttccac
ctggccaacatcaccgaacaggtgcaccgtggccgggagctgcgggccaggcgcgccgcc
gagggcggcctcctcgcccgcacggcggaccggctgaaggacgccgaccccgagcacctg
cgccagtccgtgcagaacctcaacgtgcgcccggtgttcaccgcgcaccccaccgaggcc
gcgcgccggtcggtcctcaacaagctccggcgcatcgccgcgctcctggacaccccggtc
ctcccctccgaccgccgccgccacgacgtccggctcgccgagaacatcgacctggtctgg
cagacggacgagctgcgcgtcgtgcgtcccgagcccgccgacgaagcccgcaacgccatc
tactacctcgatgagctacatgccgacgccgtcggcgacgtcctcgaagacctcaccgcc
gaactggaacgcgtcggggtcacggtgcccgacgccacccgtcccctcaccttcggcacc
tggatcggcggtgaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtc
ctcatcctccagcacgaacacggcatcaacgacgccctggagacgatcgacgaactgcgc
ggcctgctgtcccactccatccgctacaccggtgccaccgaggaactcctcgactccctc
aaggccgacctcgaacgcctgcccgagatcagcccccgttacaagcgcctcaacgccgag
gagccctaccggctgaaggccacctgcatccggcagaagctggcgaacaccaagcagcgc
ctggccaccggtaccccccacgaggagggccgcgactacctcggcaccggtcagctcctc
aaggacctgcggatcatccaggcctccctgcgcgagcaccgcggtggcctcttcgccgac
ggccgcctcgcccgcaccatccgcaccctggcggccttcggcctccaactcgccaccatg
gacgtccgtgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccgcctc
ggcgaggaatcctggcgctatgccgacatgccccgcgagtaccgggccaagctccttgcc
aaggagctgaggtcgaggaggccgctggcccccaccccggcacccgtcgacgcgcccggc
accaagactctcggcgtcttcgagacggtcaagaaggccctggagaccttcggccccgag
gtcatcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgcc
gtcctcgcccgtgaggccggcctcgtcgacctgcacgccggctgggccaggatcggcatc
gtccccctcctggagaccaccgacgaactgcgtgccgccgacaccatcctggaggacatg
ctctctgacccgtcctaccggcgcctggtcgcgctgcgcggtgacgtacaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcggcgcctgcgcgacgtcgcccaccgctacggcgtacgcctccggctcttc
cacggccgtggcggcaccgtcggccgcggtggcggtccctcccacgacgccatcctcgcc
cagccctggggcaccctggagggcgagatcaaggtcaccgaacagggcgaggtcatctcc
gacaagtacctcatcccgtccctggctcgggagaacctggaactgacggtcgcggccacc
ctgcaggcctccgccctgcacaccgccccccgccagtccgacgaggccctcgcccgctgg
gacgcggccatggatgtcgtctcggacgccgcccacggtgcctaccgcaggctcgtggag
gaccccgacctcccggcgtacttcttcgcctccaccccggtcgaccagctcgccgaactc
cacctcggctcccggccctcccgacgccccgactccggcgccggcctcgacggcctgcgc
gccatcccgtgggtgttcggctggacccagtcccggcagatcgtccccggctggttcggc
gtcggctccggcctcaaggccctgcgcgaggcgggcctgcggtatgaaggggacaccgtg
ctcgacgagatgcaccagcagtggcacttcttccgcaacttcatctccaacgtcgagatg
accctggccaagaccgacctgcggatcgcccagcactacgtcgacaccctggtcccggac
gagctgaagcacgtcttcgacaccatcaaggccgaacacgaactcaccgtccgcgaggtg
ctgcgggtcaccggcgagaacgagctcctcgacgcccagccggtcctcaggcagaccttc
ggcatccgggacgcctacctggacccgatttcctacctccaggtcaccctgctcaagcgg
cagcgtgacgccgccgacgcgggagcgacgcccgacccactgctctcccgcgccctgctc
ctcaccgtgaacggcgttgccgccggcctgcgcaacacgggctga

DBGET integrated database retrieval system