KEGG   Streptomyces pluripotens: LK06_020325Help
Entry
LK06_020325       CDS       T04845                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
splu  Streptomyces pluripotens
Pathway
splu00020  Citrate cycle (TCA cycle)
splu00270  Cysteine and methionine metabolism
splu00620  Pyruvate metabolism
splu00630  Glyoxylate and dicarboxylate metabolism
splu00680  Methane metabolism
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
splu01120  Microbial metabolism in diverse environments
splu01130  Biosynthesis of antibiotics
splu01200  Carbon metabolism
Module
splu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
splu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
splu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LK06_020325
   00620 Pyruvate metabolism
    LK06_020325
   00630 Glyoxylate and dicarboxylate metabolism
    LK06_020325
  09102 Energy metabolism
   00680 Methane metabolism
    LK06_020325
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LK06_020325
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     LK06_020325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ARP71909
UniProt: A0A221P2Z5
LinkDB All DBs
Position
4501699..4502688
Genome map
AA seq 329 aa AA seqDB search
MTRTPVNVTVTGAAGQIGYALLFRIASGQLLGADVPVKLRLLEITPALKAAEGTAMELDD
CAFPLLQGIDISDDPNVAFDGANVALLVGARPRTKGMERGDLLEANGGIFKPQGKAINDH
AADDIKVLVVGNPANTNALIAQAAAPDVPAERFTAMTRLDHNRALTQLAKKTGTPVADIT
RLTIWGNHSATQYPDIFHATVAGKNAAETVNDEKWLAEDFIPTVAKRGAAIIEARGASSA
ASAANAAIDHVHTWVNGTAQGDWTSMGIPSDGSYGVPEGLISSFPVTCKDGAYEIVQGLE
INEFSRARIDASVKELADEREAVRALGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactcccgtgaacgtcaccgtcaccggcgcggccggccagatcggttacgcc
ctgctcttccgcatcgcctccggccagctgctcggcgcggacgtgccggtcaagctgcgc
ctgctggagatcaccccggcactcaaggccgccgagggcacggccatggagctggacgac
tgcgccttcccgctgctgcagggcatcgacatctcggacgacccgaacgtcgccttcgac
ggcgccaacgtggccctcctcgtaggcgcccgtccgcgcaccaagggcatggagcgcggc
gacctgctggaggccaacggcggcatcttcaagccgcagggcaaggccatcaacgaccac
gccgcggacgacatcaaggtgctcgtggtcggcaacccggccaacaccaacgcgctcatc
gcgcaggccgctgcgccggacgtcccggccgagcgcttcaccgcgatgacccgtctggac
cacaaccgcgcgctgacccagctcgcgaagaagacgggcaccccggtcgccgacatcacg
cgcctgaccatctggggcaaccactccgccacccagtacccggacatcttccacgccacc
gtcgccggcaagaacgccgccgagaccgtcaacgacgagaagtggctggccgaggacttc
atcccgactgtcgccaagcgtggtgcggccatcatcgaggcgcgtggcgcctcgtcggcc
gcctccgccgccaacgccgccatcgaccacgtccacacctgggtcaacggcaccgcccag
ggcgactggacctccatgggtattccgtcagacggttcctacggcgttccggagggcctg
atctcctctttcccggtcacctgcaaggacggcgcgtacgagatcgtccagggcctggag
atcaacgagttctcccgcgcccgcatcgacgcctccgtcaaggagctggcggacgagcgc
gaggcggtccgcgccctgggcctcatctga

DBGET integrated database retrieval system