KEGG   Streptomyces pluripotens: LK06_020465Help
Entry
LK06_020465       CDS       T04845                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
splu  Streptomyces pluripotens
Pathway
splu00020  Citrate cycle (TCA cycle)
splu00190  Oxidative phosphorylation
splu00650  Butanoate metabolism
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
splu01120  Microbial metabolism in diverse environments
splu01130  Biosynthesis of antibiotics
splu01200  Carbon metabolism
Module
splu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
splu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
splu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LK06_020465
   00650 Butanoate metabolism
    LK06_020465
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LK06_020465
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LK06_020465
    1.3.5.4  fumarate reductase (quinol)
     LK06_020465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Fer4_4 Fer4 Fer4_18 Fer4_6 Fer4_2 Fer4_21 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ARP71930
UniProt: A0A221P1X4
LinkDB All DBs
Position
complement(4530838..4531617)
Genome map
AA seq 259 aa AA seqDB search
MATPVLDKADAAGEPEPGFADTPNITVTFRVRRFNPEVSAESVWEDFQLEIDPKERVLDG
LHKIKWDVDGSLTFRRSCAHGICGSDAMRINGKNRLACKTLIKDINPEKPITIEPIKGLT
VLKDLVVDMEPFFQAYRDVMPFLIAHDKNEPTRERLQSAEDRERFDDTTKCILCAACTSS
CPVFWNDGQYFGPAAIVNAHRFIFDSRDDAAEQRLEILNDRDGVWRCRTTFNCTDACPRG
IEVTKAIQEVKRALITRRY
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggctacccctgttctggacaaggcggacgcggccggcgagcccgagcccggcttcgcc
gacacccccaacatcacggtcaccttccgcgtccgccggttcaacccggaggtctcggcc
gagtcggtctgggaagacttccagctggagatcgacccgaaggagcgggtcctcgacggc
ctccacaagatcaagtgggacgtcgacggcagcctcaccttccgccgttcgtgcgcgcac
ggcatctgcggctcggacgcgatgcggatcaacggcaagaaccgccttgcctgcaagacg
ctgatcaaggacatcaaccccgagaagccgatcacgatcgagcccatcaagggcctgacg
gtcctgaaggacctggtcgtggacatggagccgttcttccaggcgtaccgggacgtcatg
ccgttccttatcgcccacgacaagaacgagccgacccgggagcggttgcagtccgccgag
gaccgcgagcgcttcgacgacaccaccaagtgcatcctgtgcgccgcgtgcacgtcgtcc
tgcccggtgttctggaacgacggccagtacttcggtccggccgcgatcgtgaacgcccac
cggttcatcttcgactcgcgcgatgatgccgctgagcagcggctggagatcctcaacgac
cgcgacggcgtgtggcgctgccgcacgaccttcaactgcacggacgcctgcccgcgcggt
atcgaggtcacgaaggcgatccaggaagtcaagcgcgccctgatcacgcgccgctactga

DBGET integrated database retrieval system