KEGG   Streptomyces pluripotens: LK06_020470Help
Entry
LK06_020470       CDS       T04845                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
splu  Streptomyces pluripotens
Pathway
splu00020  Citrate cycle (TCA cycle)
splu00190  Oxidative phosphorylation
splu00650  Butanoate metabolism
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
splu01120  Microbial metabolism in diverse environments
splu01130  Biosynthesis of antibiotics
splu01200  Carbon metabolism
Module
splu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
splu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
splu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LK06_020470
   00650 Butanoate metabolism
    LK06_020470
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LK06_020470
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LK06_020470
    1.3.5.4  fumarate reductase (quinol)
     LK06_020470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 HI0933_like Pyr_redox_2 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ARP71931
UniProt: A0A221P294
LinkDB All DBs
Position
complement(4531617..4533371)
Genome map
AA seq 584 aa AA seqDB search
MKIHKYDTVIVGAGGAGMRAAIEATKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTIKGGDYLVDQDAAEILAKEAIDAVLDLEKMGLPFNRTPNGTIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLIIEVDGVKKSAGV
VAYELATGEIHIFQAKAVIYASGGCGKFFKVTSNAHTLTGDGQAAVYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPEGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLADNTTVVPGLYAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYAHT
ADFVELPENPESLVVEQIEQLRGSTGSERVATLRRELQETMDANVMVFRTEQTIKTAVEK
IAELRERYKNVAIQDKGRRFNTDLLEAIELGNLLDLAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGADGAETVRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccacaagtacgacaccgtcatcgtcggcgccggtggcgcgggcatgcgtgcc
gccatcgaggcgacgaagcgcagccgcaccgcggtgctgaccaagctctaccccacccgc
tcccacacgggcgccgcgcagggcggcatggccgccgcgctggcgaacgtggaggaggac
aactgggagtggcacaccttcgacacgatcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgacgcggtcctcgacctggagaagatgggc
ctgccgttcaaccggacgccgaacggcaccatcgaccagcgccgcttcggcggtcacagc
cgcaaccacggtgaggccccggtccgccgctcctgctacgcggccgaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggaccagctgatcatcgaggtcgacggcgtcaagaagtcggccggtgtg
gttgcgtacgagctggccaccggcgagatccacatcttccaggcgaaggcggtcatctac
gcctccggcggttgcggcaagttcttcaaggtgacctccaacgcgcacaccctcaccggt
gacggccaggccgccgtctaccgccgcgggctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcgcatgggcatcctgctcaccgagggcgcccgcggtgag
ggcggcatcctgcgcaacaaggacggcgagcgcttcatggagaagtacgctcccgtcatg
aaggacttggcgtcccgtgacgtcgtgtcccgctccatctacacggagatccgcgagggt
cgcggctgcggtcccgagggcgaccacgtctacctcgacctgacgcacctcccgccggag
cagctggacgccaagctcccggacatcaccgagttcgcgcgcacctacctcggcatcgag
ccctacacggacccgatcccgatccagccgaccgcgcactacgcgatgggcggcatcccg
accaacgtcgagggtgaggtcctggcggacaacaccacggtcgtccccggcctgtacgcg
gccggcgaggtcgcctgtgtctccgtgcacggtgccaaccgcctcggcaccaactcgctg
ctggacatcaacgtcttcggccgccgcgcgggcatcgccgccgccgagtacgcccacacg
gcggacttcgtcgagctgccggagaacccggagtccctcgtggtcgagcagatcgagcag
ctgcgcggctcgaccggcagcgagcgggtggcgaccctgcgccgcgagctgcaggagacc
atggacgccaacgtgatggtgttccgcaccgagcagacgatcaagacggcggtcgagaag
atcgccgagctgcgcgagcgctacaagaacgtggcgatccaggacaagggcaggcggttc
aacacggacctgctggaggccatcgagctgggcaacctgctggacctggccgaggtcatg
gccgtctcggcgctggcccgcaaggagtcccgcggcggtcactaccgcgaggactacccg
aaccgcgacgacgtcaacttcatgcgccacacgatggcgtaccgcgaggtcggcgccgac
ggcgcggaaaccgtccgtctcgactacaagccggtcgtccagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system