KEGG   Streptomyces pluripotens: LK06_021720Help
Entry
LK06_021720       CDS       T04845                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
splu  Streptomyces pluripotens
Pathway
splu00020  Citrate cycle (TCA cycle)
splu00190  Oxidative phosphorylation
splu00650  Butanoate metabolism
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
splu01120  Microbial metabolism in diverse environments
splu01130  Biosynthesis of antibiotics
splu01200  Carbon metabolism
Module
splu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
splu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
splu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LK06_021720
   00650 Butanoate metabolism
    LK06_021720
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LK06_021720
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LK06_021720
    1.3.5.4  fumarate reductase (quinol)
     LK06_021720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_17 Fer4_18 Fer4_7 Fer4_9 DUF1126 Fer4_10
Motif
Other DBs
NCBI-ProteinID: ARP72131
UniProt: A0A221P2V3
LinkDB All DBs
Position
complement(4820032..4820802)
Genome map
AA seq 256 aa AA seqDB search
MSGYQASVKVWRGDEQGGGLKDFTVEANDGEVVLDIVHRLQATQAPDLAVRWNCKAGKCG
SCSAEINGRPRLMCMTRMSVFDRAETITITPLRTFPVIRDLVTDVGFNYRKAREVPAFAP
PPGLGPGEYRMLQEDVDRSQEFRKCIECFLCQDTCHVVRDHEENKTAFAGPRFLMRIAEL
DMHPLDSAAGRGLDRARTAQDAHGLGYCNITKCCTEVCPEGIRITDNALIPMKERAADRK
YDPLVWLGSKIRRWSS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctaccaggccagtgtgaaggtgtggcgcggcgatgagcagggcggtggcctc
aaggacttcacggtcgaggcgaacgacggcgaggtcgtcctggacatcgtccaccgtctc
caggcgacgcaagcgcccgacctggcagtgcgctggaactgcaaggcgggcaagtgcggt
tcgtgctcggctgagatcaacggccgaccgcgcctgatgtgcatgacccgcatgtcggtg
ttcgaccgtgcggagacgatcaccatcacaccgctgcgcaccttcccggtgatccgggac
ctggtgacagacgtcggcttcaactaccgcaaggccagggaggtcccggcgttcgcaccg
ccgcccgggctcggtcccggcgagtaccggatgctgcaggaggacgtggaccgctcgcag
gagttccgcaaatgcatcgagtgcttcctgtgccaggacacctgccatgtggtccgtgac
cacgaggagaacaagacggcgttcgccggaccgcgcttcctgatgcgcatcgccgaactc
gacatgcatccgctcgactcggccgccggaaggggcctggaccgtgcgcgcaccgcacag
gacgcacacggtctcggctactgcaacatcaccaagtgctgcaccgaggtctgccccgag
ggcatcaggatcacggacaacgcgctgatccccatgaaggaacgggccgccgaccgcaag
tacgacccgctggtgtggctgggatcgaagatcaggaggtggtcttcctag

DBGET integrated database retrieval system