KEGG   Streptomyces pluripotens: LK06_021750Help
Entry
LK06_021750       CDS       T04845                                 

Definition
(GenBank) ABC transporter permease
  KO
K02034  peptide/nickel transport system permease protein
Organism
splu  Streptomyces pluripotens
Pathway
splu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:splu00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LK06_021750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_021750
Transporters [BR:splu02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    LK06_021750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 OppC_N
Motif
Other DBs
NCBI-ProteinID: ARP72137
UniProt: A0A221P2L0
LinkDB All DBs
Position
4829053..4830087
Genome map
AA seq 344 aa AA seqDB search
MTSPIDIEGGGSSVVVDGGPGAEAKSDVVELEGRSPGRLMWTRFKRDRTGVISAYVVGFF
FLVGLFAPLISKLYGKDPYTVYADERPELFDSAGVPVQPNGGISGKFWFGLEPGNGYDVF
TKLIYGIRTSLTISVVVTVAVVVTAILLGVTAGYLGGKTDYFLGRLIDFLLAFPAQLFFI
ASMPVVVSLFVSPRDETPTYVRVIALITVQWFLGWMGLGRILRGTALALREREFIEAAKV
SGASSWRIIRKEILPNIVTPLLVQATYLLPGFVTAEAGLSYLGVGIVQPTPDWGQMFAKA
STELVMQNDITYMFFPGVSMIIFVVAFNLLGDSVRDAFDPKTAR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagtcctatcgacattgagggcggcggaagttcggtcgtcgtcgacggcggacca
ggggcggaagcgaagagcgacgtcgtcgaactcgaaggccgctctcccggccggctgatg
tggacgcgtttcaagcgtgaccgcaccggcgtgatctcggcctacgtcgtgggcttcttc
tttctggtcgggctgttcgccccgctgatctccaagctgtacggcaaggacccgtacacg
gtgtacgcggacgagcgcccggagctcttcgacagcgccggtgtaccggtgcagcccaac
ggcggtatcagcgggaagttctggttcggtctcgaacccggaaacggctacgacgtcttc
accaagctgatctatggcatccgcacctcgctgacgatctccgtcgtcgtcaccgtcgca
gtggtcgtgaccgccatcctgctcggcgtcaccgccggctacctgggcggaaagaccgac
tacttcctcggtcggctcatcgacttcctgcttgccttcccggcccagctgttcttcatc
gccagcatgccggtcgtggtctccctgttcgtcagcccgcgcgacgagacgcccacgtac
gtccgcgtcatcgcgctgatcacggtccagtggttcctgggctggatgggtctcggtcgc
atcctgcggggtaccgcactcgccctgcgcgaacgggagttcatcgaggcagccaaggtc
agcggggcgtcctcgtggcggatcatccgcaaggagatcctgccgaacatcgtcacgccg
ttgctggtgcaggcgacgtacctgctgcccggcttcgtgaccgccgaggccgggctgtcc
tacctgggcgtgggcatcgtccaaccgacgccggactggggccagatgttcgccaaggcc
tccaccgaactggtgatgcagaacgacatcacctacatgttcttccccggcgtctcgatg
atcattttcgtggtcgcgttcaacttgctaggggactcggtcagggacgcgttcgatccc
aagaccgcgcgctga

DBGET integrated database retrieval system