KEGG   Streptomyces pluripotens: LK06_021935Help
Entry
LK06_021935       CDS       T04845                                 

Definition
(GenBank) 3-methyladenine DNA glycosylase
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
splu  Streptomyces pluripotens
Pathway
splu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:splu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LK06_021935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:splu03400]
    LK06_021935
Enzymes [BR:splu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     LK06_021935
DNA repair and recombination proteins [BR:splu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     LK06_021935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco HHH_2
Motif
Other DBs
NCBI-ProteinID: ARP72169
UniProt: A0A221P2K4
LinkDB All DBs
Position
4870690..4871322
Genome map
AA seq 210 aa AA seqDB search
MSDGAALAGPDGGLRCPWALSTEDYVAYHDQEWGRPVHGDDALFERVSLEAFQSGLSWIT
ILRRRPGFRAAFAGFRIEEVAAFSDEDRERLLADPGIIRNRAKIDATMANARVLAGWATG
ELDELIWSHAPDPAGRPAPKTLADVPAITPESTALSKALKKRGLRFVGPTTAYALMQACG
LVDDHLEACVARTSGPSRGAPSGGVPAPGR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggagccgcccttgccgggccggacgggggcctgcgctgtccgtgggccctg
tccaccgaggactacgtggcctaccacgaccaggagtggggccgcccggtccacggagat
gacgccctcttcgagcgggtcagcctagaggccttccagtccggcctgtcctggatcacg
atcctgcgccgccgccccggtttccgtgctgccttcgccggcttccgcatcgaggaggtc
gccgccttctccgatgaggaccgcgagcggctgctggccgaccccggcatcatccgcaac
cgcgccaagatcgacgcgacgatggcgaacgcgcgggtgctcgccggctgggcaacgggc
gagctggacgagttgatctggtcccacgctccggatccggccggccgcccggctccgaag
acccttgccgacgttccggcgatcacccccgagtccaccgccctgtcgaaggcactgaag
aagcgtggtctcagattcgtcggcccgacgacggcgtacgcgctgatgcaagcgtgcggg
ctggtggacgatcacctggaagcctgcgtcgcgcgtacctccggtccgtctcgcggtgcc
ccctcagggggagttccggcaccgggccggtga

DBGET integrated database retrieval system