KEGG   Streptomyces pluripotens: LK06_021940Help
Entry
LK06_021940       CDS       T04845                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K15866  2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase [EC:5.3.3.18]
Organism
splu  Streptomyces pluripotens
Pathway
splu00360  Phenylalanine metabolism
splu01100  Metabolic pathways
splu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LK06_021940
Enzymes [BR:splu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.18  2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase
     LK06_021940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ARP72170
UniProt: A0A221P2Z8
LinkDB All DBs
Position
complement(4871385..4872188)
Genome map
AA seq 267 aa AA seqDB search
MADTVLYEVSDGLATITLNRPDAMNALNVASKVALREAAEAAAGDSAVRAILLTAAGERA
FCVGQDLKEHIGLLAEDRETGAGQTMSTVKEHYNPIVRALAGAPKPVVAAVNGVAAGAGL
GFALAADYRIVADTAGFNTSFAGVALTADSGISWTLPRVVGPSRATDLLLFPRSISAQDA
LELGIANRVVPAPELRAEAEKTARALAQGPTVAYAALKEAVAFGLTHSLAETLEKEDELQ
TRAGQSEDHAIAVQAFVNKERPKYLGR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccgtgctctacgaggtgagcgacggactcgcgacgatcacgctgaaccgc
cccgatgcgatgaacgcgctgaacgtcgcgtccaaggtcgccctacgggaggcggcggag
gcagcggccggggactcggccgtacgggcgatcctgctgaccgccgccggagaacgcgcg
ttctgcgtgggccaagacctcaaggagcacatcggactgctcgccgaggaccgggagacc
ggggccgggcagacgatgagtacggtcaaggagcactacaacccgatcgtgcgggccctc
gccggggcgcccaagccggtggtcgcagcggtgaacggagtcgcggccggggccggcctc
ggcttcgcgctcgcggccgactaccggatcgtggccgacacagcgggcttcaacacctcc
ttcgccggcgtcgcgctgaccgcagactccgggatctcctggacccttccccgtgtggtc
ggccccagccgcgccaccgacctgctgctcttcccgcgcagcatcagcgcccaggacgcc
cttgagctgggcatcgccaaccgggtcgtccccgcgcccgagctgcgagccgaggccgag
aagaccgcgcgggcactggcccagggcccgacggtggcgtacgcggcactgaaggaggcg
gtggccttcggcctgacgcactccctcgccgagacgctggagaaggaggacgagctgcag
acccgcgccgggcagtccgaggaccacgcgatcgcggtgcaggcgttcgtgaacaaggag
aggccgaagtacctcggccggtag

DBGET integrated database retrieval system