KEGG   Streptomyces pluripotens: LK06_021990Help
Entry
LK06_021990       CDS       T04845                                 

Definition
(GenBank) magnesium transporter
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtE_N CBS FliG_M PRC FliG_N hnRNP_Q_AcD
Motif
Other DBs
NCBI-ProteinID: ARP72178
UniProt: A0A221P2Y2
LinkDB All DBs
Position
complement(4880981..4882282)
Genome map
AA seq 433 aa AA seqDB search
MAAGAPRIFVSHLAGVPVFDPAGDQVGRVRDLVVMLRVGRRPPRVLGLVVELSTRRRIFL
PMTRVTGIESGQVITTGVLNVRRFEQRPTERLVFGELLDRRVTLVETGEEVTVLDVSVQQ
LPARRDWEVDRVFVRKGKKTGAFRRAKGETLTAEWSAVTGFSLEEHGQGAESLLATFEQL
RPADLANVLHHLSPKRRAEVAAALDDDRLADVLEELPEDDQIEVLGKLKEERAADVLEAM
DPDDAADLLSELPEEDKERLLSLMKPADAADMRRLMSYEEHAAGGLMTTEPIVLRPDATV
ADALARVRNPDLSPALAAQVYVCRPPDETPTGKYLGTVHFQRLLRDPPYTLVSSLVDDDL
QPLAPDAALPVIAGFFATYDMVAAPVVDEAGSLLGAVTVDDVLDHMLPEDWRETEFHLNE
ATEADEGAGSHGP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggcgccccccggatcttcgtctcgcacctcgccggggtccccgtcttcgac
ccggccggcgaccaggtgggccgcgtccgcgatctggtcgtcatgctgcgcgtcgggcgc
cggcccccacgcgtcctcgggctggtcgtcgagctgtccacccggcgccgcatcttcctg
cccatgaccagggtcaccggcatcgaatccggacaggtcatcaccacgggggtcctgaac
gtacgacgcttcgagcagcgccccaccgagcgactggtcttcggcgaactgctggaccgg
cgcgtgaccctggtggagaccggcgaggaggtcaccgtcctggacgtgtccgtgcagcag
ctgcccgcacgccgggactgggaggtcgaccgcgtcttcgtccgcaaggggaagaagacc
ggtgccttccggcgggccaagggggaaacgttgaccgcagagtggtcggccgtcaccggg
ttctccctggaggagcacgggcagggcgccgagagcctgctcgccaccttcgagcaactg
cgccctgccgacctcgccaatgtgctgcaccacctctcccccaagcggcgcgccgaggtc
gccgcagccctggacgacgaccggctcgccgacgtgctggaggaactgcccgaggacgac
cagatcgaggtcctcggcaaactgaaggaggaacgcgcggcggacgtcctggaggccatg
gaccccgacgacgcggccgacctgctctccgagctgcccgaggaggacaaggaacggctg
ctgagcctcatgaagcccgcggacgccgccgacatgcgacgcctgatgtcgtacgaggaa
cacgcggccggcggtctgatgaccaccgagccgatcgtgctgcgcccggacgccacggtc
gccgacgcgctcgcccgggtccgcaacccggacctctccccggccctcgccgcacaggtc
tacgtctgccgcccaccggacgagaccccgaccggcaagtacctgggcacggtgcacttc
cagcggctgctccgtgaccccccgtacacgctggtcagctcactggtggacgatgatctg
cagcccttggccccggatgccgcactgccggtgatcgccgggttcttcgccacctacgac
atggtggcggcgcccgtggtggacgaggccgggtccttgctgggcgcggtgaccgtggac
gacgtgctggaccacatgctgcccgaggactggcgggagacggagttccacctgaacgag
gcgaccgaggcggacgagggagctggttcccatggcccctga

DBGET integrated database retrieval system