KEGG   Streptomyces pluripotens: LK06_022010Help
Entry
LK06_022010       CDS       T04845                                 

Definition
(GenBank) Suppressor of fused domain protein
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUFU
Motif
Other DBs
NCBI-ProteinID: ARP72182
UniProt: A0A221P2J7
LinkDB All DBs
Position
4885598..4886182
Genome map
AA seq 194 aa AA seqDB search
MVDVLPLVEARLHTALGEPDARAAVTFLGADRIEVLRFQEADVLRYATLGMSRHPMTDPT
AMVADPVEGPRAELVLSVRAGVADTAKVLRPLAVLAASPQVEGLVVVPGASLDVGEPLWP
DAPFTSVLVGESGGLVEDLELDAPMDPVRFLPLLPMTPNEAAWKRVHGAQALQERWLAQG
TDLRDPSRRSVPLD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgttcttcctctggtcgaggcacggttgcacaccgcgctgggcgaaccggac
gcgcgtgccgcggtcaccttcctcggtgcggaccgcatcgaagtgctccgcttccaggag
gcagacgtcctcaggtacgccacccttggtatgtcccggcaccccatgacggaccccacg
gcgatggtcgcggacccggtcgagggtcccagggccgaactggttctgtccgtccgtgcg
ggcgtcgccgacacggccaaggtgctccgcccgcttgccgtcctcgcggcatccccccag
gtggagggcctggtggtggtccccggcgcgtcattggacgtgggtgagccgttgtggccc
gacgcccccttcacctcggtcctggtgggcgaatcaggggggctcgtggaggatctggaa
ctggacgcaccgatggaccccgtacggttcctgccgctgttgccgatgacaccgaacgag
gccgcgtggaagcgggtgcacggtgctcaggccctccaggagcgctggctcgcgcagggg
acggatctgagggatccctcccgccggtccgtcccgctcgactga

DBGET integrated database retrieval system