KEGG   Streptomyces pluripotens: LK06_022175Help
Entry
LK06_022175       CDS       T04845                                 

Definition
(GenBank) ABC transporter ATP-binding protein
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC1 APH
Motif
Other DBs
NCBI-ProteinID: ARP72211
UniProt: A0A221P2K3
LinkDB All DBs
Position
complement(4928865..4930235)
Genome map
AA seq 456 aa AA seqDB search
MSDLPRKAVTRTAKLAALPLGFAGRATWGLGKRIVGESAEIVGRELQQRTAEQLFKVLGE
LKGGAMKFGQALSVFESALPEEIAGPYRAALTKLQEAAPPMPTRTVHTVLEERLGPGWRD
FFEEFEDKPAAAASIGQVHRAVWHDGREVAVKVQYPGAGEALLSDLGQLSRFARLLGPLI
PGMDVKPLIAELKDRVSEELDYELEARAQTAHAEEFAGDPDMVVPAVVHQCEQVLVTEWI
DGIPLSEIITDGTQEQRDRAGQLLARFLFSGPARTGLLHADPHPGNFRLLPGGPTGKEEW
RLGVLDFGTVDRLPGGLPLPIGVSLRMTLGGDAETVYELLCAEGFVKDSIELDPDAVLDY
LLPIIEPARVDAFTFTRSWMRSQAARIADPRSPAYQLGKRLNLPPAYLLIHRVTLSTIGV
LCQLGATVQLREELQAWLPGFAPEGDPQEEEPAAGA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcttccccggaaggcggtcacccgtaccgccaagctcgccgcgctcccgctc
ggcttcgccggccgggcgacctgggggctgggcaagcggatcgtgggcgagtccgcggag
atcgtcggccgggaactgcaacagcgcacggctgaacaattgttcaaggtgctcggcgag
ctcaagggcggtgcgatgaagttcgggcaggccttgtccgtcttcgagtccgcgttgccc
gaggagatcgccggcccctaccgtgcggccctcaccaagctccaggaggcagcaccgccc
atgccgacccgtaccgtgcacacggtgcttgaggaacggctggggccgggctggcgcgac
ttcttcgaggagttcgaagacaagccggccgctgctgcctcaatcggccaggtgcaccgg
gccgtgtggcacgacggccgcgaagtggcggtcaaggtgcagtatccgggcgccggtgag
gctctgctgtccgatctcggacaactgagtcgcttcgcccggttgttgggtcctctcatt
ccgggcatggacgtcaagccgctcatcgccgagctgaaggaccgcgtttcggaggaactg
gattacgaactggaggcccgggcccagacggcacatgcagaggagttcgccggcgacccg
gacatggtggtcccggcggtggtccaccagtgcgagcaggttctggtgaccgagtggatc
gacggcatcccgctgtcggagatcatcacggacggcacccaggagcagcgcgaccgggcc
ggtcagctcctcgcccgcttcctgttctcgggcccggcccgcaccggcctgctgcacgcc
gatccccatccgggcaacttccgtctgctgcccggcggcccgaccggcaaggaggagtgg
cgtctgggcgtcctggacttcggcacggtcgaccggctccccggcggactgcccctgccg
atcggcgtctccctgcggatgacactgggcggcgatgccgagacggtctacgaactcctc
tgcgcggaaggattcgtgaaggactccatagagctcgaccccgacgcggtcctcgactac
ctcctgccgatcatcgagccggctcgggtcgacgcgttcaccttcacccgctcctggatg
cgcagccaggccgcgcggatcgctgacccgcgctcccccgcctatcagctgggcaagcgg
ctcaatctgccgcccgcctatctgctgatccaccgggtgacgctgagcacgatcggggtg
ctctgccagctgggtgccacggtgcagctgcgggaggaactccaggcgtggctgccggga
ttcgcgccggaaggcgacccgcaggaggaggaaccggctgcgggggcttga

DBGET integrated database retrieval system