KEGG   Streptomyces pluripotens: LK06_022220Help
Entry
LK06_022220       CDS       T04845                                 

Definition
(GenBank) molybdopterin biosynthesis protein MoeE
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
splu  Streptomyces pluripotens
Pathway
splu00790  Folate biosynthesis
splu01100  Metabolic pathways
splu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LK06_022220
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    LK06_022220
Enzymes [BR:splu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     LK06_022220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE
Motif
Other DBs
NCBI-ProteinID: ARP72220
UniProt: A0A221P2N4
LinkDB All DBs
Position
4939173..4939631
Genome map
AA seq 152 aa AA seqDB search
MAVTNDHPGEQAAQEPIKLIGVRDTALSVDEVFQAVGDAAAGGIALFAGTVRNHDGGADV
DALGYSCHPRAEAELRRIAEKVVADHPVRALAAVHRVGELRVGDLAVVVAVACPHRAEAF
EACRRLIDDLKHEVPIWKHQTFSDGTEEWVGA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcacgaacgaccacccgggtgagcaggcggctcaggagcccatcaagctgatc
ggcgtccgggacaccgcgctctccgtggacgaggtgttccaggccgtcggggacgcggcg
gccgggggtatcgcgctgttcgcggggaccgtgcggaaccacgacgggggcgccgacgtg
gatgcgctcgggtactcctgtcatccccgtgcggaggcggagctgcggcggatcgcggag
aaggtcgtcgctgaccacccggtgcgggcactggccgccgtccaccgggtgggcgagcta
cgggtcggggatctggccgtcgtcgtcgccgtggcctgcccgcaccgggcggaggccttc
gaggcctgccggaggctgatcgacgacctcaagcacgaagtgcccatctggaagcaccag
acgttctccgacggtactgaggaatgggtaggcgcgtag

DBGET integrated database retrieval system