KEGG   Streptomyces pluripotens: LK06_022345Help
Entry
LK06_022345       CDS       T04845                                 

Definition
(GenBank) ribonucleoside-diphosphate reductase
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
splu  Streptomyces pluripotens
Pathway
splu00230  Purine metabolism
splu00240  Pyrimidine metabolism
splu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LK06_022345
   00240 Pyrimidine metabolism
    LK06_022345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:splu03400]
    LK06_022345
Enzymes [BR:splu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     LK06_022345
DNA repair and recombination proteins [BR:splu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    LK06_022345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm 4HFCP_synth DUF3792
Motif
Other DBs
NCBI-ProteinID: ARP72237
UniProt: A0A221P341
LinkDB All DBs
Position
complement(4964119..4965129)
Genome map
AA seq 336 aa AA seqDB search
MSRNTNLLDPGFELTLRPMRYPDFYERYRDAIKNTWTVEEVDLHSDVADLAKLSPGEQHL
IGRLVAFFATGDSIVANNLVLTLYKHINSPEARLYLSRQLFEEAVHVQFYLTLLDTYLPD
PEERAAAFAAIENIPSIREKAQFCFRWMDSVEKIERLETKADRRRFLLNLICFAACIEGL
FFYGAFAYVYWFRSRGLLHGLATGTNWVFRDETMHMSFAFEVVDTVRKEEPDLFDDVLQQ
QVTDMLAEAVEAELQFARDLCGEGLPGMNTDSMRQYLECVADQRLTRLGFAPVYGSENPF
SFMELQGVQELTNFFERRPSAYQVAVEGSVDLDEDF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaacaccaacctgctcgacccgggcttcgaactgaccctgcgcccgatgcgc
taccccgacttctacgagcgctaccgggacgccatcaagaacacctggaccgtggaggag
gtcgacctccactcggacgtggccgacctcgccaagctgagcccgggtgagcagcacctg
atcggccggctggtcgcgttcttcgccaccggcgactcgatcgtcgcgaacaacctggtg
ctgaccctctacaagcacatcaactccccggaggcgcggctgtacctgagccggcagctc
tttgaggaggccgtccacgtccagttctacctgacgctgttggacacctacctccccgac
ccggaggagcgcgcggcggccttcgcggcgatcgagaacatcccctccatccgggagaag
gcgcagttctgcttcaggtggatggactccgtcgagaagatcgagcggctggagacgaag
gctgaccgccgccgcttcctgctcaacctgatctgcttcgccgcctgcatcgagggtctc
ttcttctacggcgcgttcgcgtacgtctactggttccgcagccggggcctgttgcacggg
ctggccaccggcaccaactgggtgttccgtgacgagacgatgcacatgtccttcgccttc
gaggtggtcgacaccgtccgcaaggaggagccggacctgttcgacgacgtgctccagcag
caggtcaccgacatgctggcggaggcggtcgaggcggagctgcagttcgcacgcgacctg
tgcggtgagggactgccgggtatgaacaccgactcgatgcggcagtacctggagtgtgtc
gccgaccagcgactcacccgcctgggcttcgcgccggtctacggttcggagaaccccttc
tccttcatggagttgcagggcgttcaggagttgaccaacttcttcgagcgccgcccgtcg
gcgtaccaggtcgcggtggagggcagcgtcgacctggacgaggacttctga

DBGET integrated database retrieval system