KEGG   Streptomyces pluripotens: LK06_022490Help
Entry
LK06_022490       CDS       T04845                                 

Definition
(GenBank) atrA protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
splu  Streptomyces pluripotens
Brite
KEGG Orthology (KO) [BR:splu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:splu02000]
    LK06_022490
Transporters [BR:splu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    LK06_022490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 TGS EntA_Immun DUF5113
Motif
Other DBs
NCBI-ProteinID: ARP72260
UniProt: A0A221P2N0
LinkDB All DBs
Position
complement(4991912..4992868)
Genome map
AA seq 318 aa AA seqDB search
MTASSTRRTTAARSRLAAVGAIAVAGALLLTGCGDHTDKNNGSGSASASAPLASKLPADI
RKSGKIVVGSDIAYPPVEYMKDGKAVGIDPDIADALGKQLGVTFEFQNGKFDNLIVGLQS
KRFQVLMSAMSDTKDRENGVNSDNGQKVGKGVDFVDYFTAGTSILVQKGNPKGVQSLDDL
CGKVVALQRGTTSEDIAKQQSKKCTKDGKKAIKLQSFDTDPEALLRLKQGASVADLNDFP
VAAYNAKTSGGGKDFEVVGEQIEAGPYGIAVSKDNTQLRDALQAALNAIIKNGEYAKIMQ
KWNVTDGAVTEAKINGGS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaagctccacccgtcgtaccaccgccgcccgctcccgtctggccgcggtgggc
gcgatcgcggtcgcaggcgccctgctgctcaccggctgcggcgaccacacggacaagaac
aacggctccggctcggcgtccgcctccgccccgctggccagcaagctgcccgcggacatt
cgcaagtcgggcaagatcgtcgtcggctccgacatcgcctacccgccggtcgagtacatg
aaggacggcaaggccgtcggtatcgacccggacatcgcggacgccctcggcaagcagctc
ggcgtcacgttcgagttccagaacggcaagttcgacaacctgatcgtgggtctgcagtcc
aagcggttccaggtcctcatgtcggccatgagcgacaccaaggaccgtgagaacggggtc
aactccgacaacggccagaaggtcggcaagggtgtcgacttcgtcgactacttcaccgcc
ggtacctcgatcctggtccagaagggcaacccgaagggcgtccagtccctggacgacctg
tgtggcaaggtcgtggccctgcagcggggcaccacgtccgaggacatcgccaagcagcag
agcaagaagtgcaccaaggacggcaagaaggccatcaagctgcagagcttcgacaccgac
cccgaggcgctgctccgcctgaagcagggcgcgtccgtcgccgacctgaacgacttcccg
gtggcggcctacaacgcgaagacctccggcggtggcaaggacttcgaggtcgtcggcgag
cagatcgaggcgggtccgtacggcatcgccgtcagcaaggacaacacccagctgcgcgac
gccctccaggccgctctgaacgcgatcatcaagaacggcgagtacgccaagatcatgcag
aagtggaacgtcacggacggcgcggtgaccgaggcgaagatcaacggcggctcctga

DBGET integrated database retrieval system