KEGG   Streptomyces pluripotens: LK06_027715Help
Entry
LK06_027715       CDS       T04845                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
splu  Streptomyces pluripotens
Pathway
splu00250  Alanine, aspartate and glutamate metabolism
splu00410  beta-Alanine metabolism
splu00640  Propanoate metabolism
splu00650  Butanoate metabolism
splu01100  Metabolic pathways
splu01120  Microbial metabolism in diverse environments
Module
splu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:splu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LK06_027715
   00650 Butanoate metabolism
    LK06_027715
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LK06_027715
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LK06_027715
Enzymes [BR:splu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     LK06_027715
Amino acid related enzymes [BR:splu01007]
 Aminotransferase (transaminase)
  Class III
   LK06_027715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ARP73135
LinkDB All DBs
Position
6275624..6276961
Genome map
AA seq 445 aa AA seqDB search
MGFLPRPPPRRLRRTGAAVKDLYSRHRRVLPDWLALYYDDPLEITHGEGRHVWDSDGNRY
LDFFGGILTTMTAHALPEVTKAVSEQAGRIIHSSTLYLNRPMVELAERIAQVSGIPDARV
FFTTSGTEANDTALLLATAHRRSNTILAMRNSYHGRSFSTVGITGNRGWSPTSLSPLQTL
YVHGSVRTRGPYAELDDQAFTDACVADLKDMLGHTRPPAALIAEPIQGVGGFTSPPDGLY
AAFREVLNAHGILWIADEVQTGWGRTGEHFWGWQAHARSGPPDIVTFAKGIGNGMSVGGV
IARSEIMNCLDAHSISTFGGTQITMAAGLANLTYLLEHDLQGNARRVGGLLIERLRSVAA
QLPGVREVRGRGLMIGIELVRPGTDEADPQAAAAVLEAARAGGLLIGKGGGHSTSALRIA
PPLSLTVAEAEEGAAILERALRSSY
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctaccgcgaccgccgccccgacgcctacgaaggactggtgcagccgtgaaa
gacctctactcccgccaccgcagggtcctcccggactggctcgccctctactacgacgac
ccgttggagatcacccacggcgagggacggcacgtctgggactccgacggcaacaggtac
ctggacttcttcggcggcatcctgaccacgatgaccgcgcacgcgctgcccgaggtgacc
aaggcggtctccgagcaggccgggcggatcatccactcctcgaccctctacctcaaccgg
ccgatggtcgaactcgccgagcgtatcgcccaggtgagcggcatcccggacgcccgggtg
ttcttcaccacgtccggcaccgaggccaatgacaccgccctgctgctcgccaccgcccac
cggcgcagcaacacgatcctcgccatgcgcaacagctaccacggccgctccttcagcacg
gtcggcatcaccggcaaccgcggctggtcccccacctcgctgtctccgctgcagacgctg
tacgtccacggctcggtgcgcacccgggggccgtacgcggaactggacgaccaggcattc
accgacgcctgtgtcgccgatctgaaggacatgctgggccacacccggccgcccgccgcg
ctgatcgccgaaccgatccagggcgtcggcggcttcacctcgccacccgacggactgtac
gcggcattccgtgaggtgttgaacgcacacgggatcctatggatcgccgatgaggtgcag
accggctggggccgcaccggagagcacttctggggctggcaggcccatgctcgcagcggt
ccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccgtcggcggagtg
atcgcccgctccgagatcatgaactgcctggacgcccacagcatctccaccttcggcggc
actcagatcaccatggccgccggtctcgccaacctcacctacctcctggaacacgacctc
cagggcaacgcccgccgggtcggcggactgctcatcgagcggctgaggtccgtcgccgcc
cagctgcccggggtgcgggaggtgcgcgggcgcggactgatgatcggcatcgagctggtc
agaccggggacggacgaggccgatccacaggccgccgccgcggtcctggaagcggcccgc
gcgggtggactgctcatcggcaagggcggcggccacagcaccagcgccctgcgcatcgcg
ccgccgctgtcgctgaccgtcgccgaggccgaggaaggcgcggccatcctcgaacgcgcg
ctgaggagttcgtactag

DBGET integrated database retrieval system