KEGG   Streptomyces pluripotens: LK06_028200Help
Entry
LK06_028200       CDS       T04845                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
splu  Streptomyces pluripotens
Pathway
splu00740  Riboflavin metabolism
splu00790  Folate biosynthesis
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
splu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LK06_028200
   00790 Folate biosynthesis
    LK06_028200
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LK06_028200
Enzymes [BR:splu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     LK06_028200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ARP73212
UniProt: A0A221P5D2
LinkDB All DBs
Position
6389703..6390362
Genome map
AA seq 219 aa AA seqDB search
MTENIGVLGKKSPRRSGAERVVNAPLPTVYGKFQAIGYLDHDRGDEQVALVYGDIGAENV
LTRLHSECLTGDAFGSRHCECGDQLAAALRAVATEGSGIVVYLRGHEGRGIGLLAKLRAM
ALQAEGLDTVEANLALGLPVDARDYRVAADILHDLNVRSVRLMSNNPRKREALVRHGIQV
AEQVPLLIEPCESNITYLRTKRERMDHHLPHLDAVAQGS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaacatcggtgtcctcggcaagaagtccccgcggcgttcgggtgcggagcgc
gtcgtgaatgccccgctgcccaccgtgtacggaaaattccaggcgatcggctacctggac
cacgaccgcggtgatgaacaagtcgccctggtatacggtgacatcggtgccgagaacgtg
ctgacgaggctgcactccgagtgcctgaccggagacgccttcggctcccgccactgcgag
tgcggtgaccaactggcggccgcactgcgcgcggtggccaccgagggcagcggaatcgtc
gtctacctgaggggccacgagggtcgcggcatcgggctcctcgccaaactgcgcgcgatg
gccctgcaggcggaggggttggacaccgtggaagcgaacctcgcgctcgggctgccggtc
gacgcccgcgactaccgcgtggcggccgacatcctgcacgacctcaacgtccgttcagtg
cggctgatgtccaacaacccgcgcaagcgagaggccctggtccgacacggcatccaggtc
gccgagcaggtgccgctgttgatcgagccctgcgagagcaacatcacctacctgcggacc
aagcgggagcggatggaccaccacctgccccatctggacgccgtggcccagggctcctga

DBGET integrated database retrieval system