KEGG   Streptomyces pluripotens: LK06_028410Help
Entry
LK06_028410       CDS       T04845                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
splu  Streptomyces pluripotens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARP73243
UniProt: A0A221P5R2
LinkDB All DBs
Position
complement(6439490..6440566)
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMQYEAKWDGFRAIVFRDRSEVELGSRTSKPLTRYFPE
LVAELRKQVPERCVLDGEIVIARNGRLDFDALTERIHPAESRVRMLAGKTPASFVAFDLL
ALDDRSLLDAPLTDRRALLERALADAAPPVHRAPATTDIDVARQWFEQFEGAGLDGVVAK
PLTLRYLQDKRAMFKIKHERTADVVVAGYRFHKSGRVLGSLLLGLYDDQGRLQHVGVSAA
FPMKRRAELVEELEPLRMDDVTGHPWAAWADGPAHETARLPGAPSRWSGKKDLSWVPLRP
ERVAEVAYDHMENGRRFRHTARFRRWRPDRAPRSCTYSQLEEPVRYDLGEILGTPDHR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcctgtgaaaccgatgctcgccaagtcggtggcgaagatc
ccgccgggaatgcagtacgaggcgaagtgggacggcttccgcgcgatcgtgttccgggac
cggtccgaggtcgagttgggcagccgcaccagcaaaccgctgaccaggtacttccccgag
ctggtcgcggagctgaggaagcaggtgcccgagcggtgcgtgctcgacggggaaatcgtg
atcgcgcgcaacggacggctggacttcgacgcgttgaccgaacggatccacccggccgaa
tcccgggtacggatgctggctgggaagaccccggcctccttcgtcgccttcgacctgctg
gcgctggatgaccgctccctgctcgatgctccgttgaccgaccgccgggcactgctggag
cgcgctctcgccgacgcggctccgccggtacacagggcgcccgcgacgaccgacatcgac
gtggcccgacagtggttcgaacagttcgagggcgccggtctcgacggagttgtcgccaaa
ccgctcacgctgcgctacctgcaggacaagcgcgccatgttcaagatcaagcacgagcgg
acggcggacgtcgtagtggccggctaccgcttccacaagagcggtcgggtgctgggctcg
ctgttgctcgggctgtacgacgatcagggcaggctccaacacgtgggcgtatcggccgcc
ttccccatgaagcggcgggccgagctggtcgaggagctggagccgctgcggatggacgac
gtgaccgggcatccgtgggcggcgtgggcagacgggcccgcgcacgagacagctcggctg
ccgggcgcgccgagccgctggtcgggaaagaaggacctgtcctgggtgccactcagaccg
gaacgggtggccgaggtcgcctacgaccacatggagaacggtcggcgtttccggcacacg
gcccgcttccgccgctggcgcccggaccgtgcaccgcgcagctgcacctactcccagctg
gaggagcccgtgcgctacgacctgggggagatcctcggcacgccggaccaccggtga

DBGET integrated database retrieval system