KEGG   Streptomyces pluripotens: LK06_031745
Entry
LK06_031745       CDS       T04845                                 

Definition
(GenBank) 2-amino-4,5-dihydroxy-6-one-heptanoic acid-7-phosphate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
splu  Streptomyces pluripotens
Pathway
splu00997  Biosynthesis of various secondary metabolites - part 3
splu01100  Metabolic pathways
splu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:splu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    LK06_031745
Enzymes [BR:splu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     LK06_031745
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: ARP73774
UniProt: A0A221P7A0
LinkDB
Position
complement(7217887..7218729)
AA seq 280 aa
MTSCLHFAREMRLGRLFRHGDGRLLITPLDHSITDGPVVPRGSTIDRLTGQLAAGGVDAV
VVHKGVLRHISPSRFAGMSLIVHLSASTRHAPDSEAKYLVTAVGDALRLGADAVSVHINM
GSADERQQIGDLGRVADLCDRWNLPLLAMVYPRGPGISNPQAPELVVHAATLAADLGADV
VKAPYAGSVAEMRDVVSACPIPLLCAGGPRFGSGTDALAFVRDALLGGAAGVAMGRNIFQ
ATDPRRMAAQVAAIVHGEPRLHKADDTEGQCDERTEAVLA
NT seq 843 nt   +upstreamnt  +downstreamnt
atgacgtcctgtctgcatttcgcccgtgagatgcggctcggtaggctgttccgtcacggg
gacggccgactcttgatcaccccgctggaccactccatcaccgacggcccggtggtgcct
cgcggcagcaccatcgaccgcctcaccggccagctggccgcgggcggtgtcgatgccgtg
gtcgtccacaagggcgtactgcggcacatcagcccgtcccgcttcgccggcatgtcgctc
atcgtgcacctcagtgcgagcactcggcacgccccggactcggaggcgaagtacctggtg
accgcggtgggggacgcgctgcggctcggcgccgatgcggtgagcgtccacatcaacatg
ggctcggcggacgagcggcagcagatcggggacctgggccgggtggcggacctgtgcgac
cgctggaacctccccctgcttgcgatggtctacccgcgcggccccggcatcagcaatccg
caggccccggagctggtggtgcacgcggcgacgctcgccgccgacctcggcgctgacgtg
gtcaaggccccgtacgcggggagcgtggccgagatgcgtgacgtggtctccgcctgcccg
atcccgctgctgtgcgcgggcggcccgcgcttcggttcgggcaccgacgcgctggcgttc
gtcagggacgccctgctcggcggcgccgccggggtcgcgatggggcgcaacatcttccag
gccactgatccccgccggatggccgcccaggtggccgccatcgtgcacggcgagccccgg
ctgcacaaggctgacgacacagaagggcagtgtgatgaacggacagaagctgtgctggct
tga

DBGET integrated database retrieval system