KEGG   Serratia plymuthica PRI-2C: Q5A_000195Help
Entry
Q5A_000195        CDS       T04576                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase [Mn]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sply  Serratia plymuthica PRI-2C
Brite
Enzymes [BR:sply01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Q5A_000195 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANS40560
UniProt: A0A1B1KJD7
LinkDB All DBs
Position
complement(43588..44208)
Genome map
AA seq 206 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELASLSVEALIQD
LDKVPADKRTFMRNNAGGHANHSLFWKGLKIGTTLGGDLKAAIERDFGSVEKFQEEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPIIGLDVWEHAYYLKYQN
KRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatccctgccgtacgcctacgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacaccaaacaccaccagacttacgtcaacaacgcgaac
accgtgctggaagcgtaccctgagctggcttcgctgagcgttgaagcgctgatccaggat
ctggataaagtgcctgccgacaagcgcactttcatgcgtaacaacgccggcggccacgct
aaccacagcctgttctggaaaggcctgaaaatcggcaccacgctgggtggcgatctgaaa
gccgctatcgagcgcgatttcggcagcgttgagaaattccaggaagagttcgagaaagcc
gcagcgacccgcttcggttcaggttgggcctggctggtgctgaaaggcgacaaactggcc
gtggtgtctaccgctaaccaggacagcccgctgatgggcgaagccgttgccggcgcttca
ggcttcccaatcattggcctggacgtgtgggaacacgcttactacctgaaatatcagaac
aaacgcccagactacatcaaggcgttctggaacgtggttaactgggacgaagcggcagca
cgcttcgctgcgaagaagtaa

DBGET integrated database retrieval system