KEGG   Serratia plymuthica PRI-2C: Q5A_002350
Entry
Q5A_002350        CDS       T04576                                 

Gene name
valS
Definition
(GenBank) Valine--tRNA ligase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sply00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q5A_002350 (valS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sply01007]
    Q5A_002350 (valS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sply03016]
    Q5A_002350 (valS)
Enzymes [BR:sply01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     Q5A_002350 (valS)
Amino acid related enzymes [BR:sply01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Q5A_002350 (valS)
Transfer RNA biogenesis [BR:sply03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Q5A_002350 (valS)
 Prokaryotic type
    Q5A_002350 (valS)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 Val_tRNA-synt_C tRNA-synt_1g tRNA-synt_1_2 ABC_tran_CTD tRNA-synt_1f
Other DBs
NCBI-ProteinID: ANS40967
UniProt: A0A1B1KKJ9
LinkDB
Position
complement(504901..507792)
AA seq 963 aa
MEKTNSHLDTAYDPKEIEQKLYDHWENQGYFKPNGDTSQESFCIMIPPPNVTGSLHMGHA
FQQTIMDTMIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEENKTRHDYGRDAFIDK
IWQWKAESGGTITRQMRRLGNSVDWERERFTMDEGLSNAVREVFVRLHKEDLIYRGKRLV
NWDPKLRTAISDLEVENRESKGSMWHLRYPLADGAKTAEGKDYLVVATTRPETVLGDTGV
AVNPEDPRYKDLIGKEIILPLVGRRIRIVGDEHADMEKGTGCVKITPAHDFNDYEVGKRH
GLPMINILTFDGDIRQEAEVFNTLGEICTDYCNEIPAQYRGLERFAARKAVVAAFEELGL
LEEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRTAPLAKVAVEAVEQGEIQFVPKQYENMY
FSWMRDIQDWCISRQLWWGHRIPAWYDVNGKVYVGRSEEEVRSENNLGADVVLTQDEDVL
DTWFSSGLWTFSTLGWPEQTDALKTFHPTSVMVSGFDIIFFWIARMIMLTMHFMKDENGK
PQVPFKTVYMTGLIRDDEGQKMSKSKGNVIDPLDMVDGISLEDLLEKRTGNMMQPQLAEK
IRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRLEGYRNFCNKLWNASRFVL
MNAEGQDCGFNGGEKVLSLADRWILAEFNRTVKAYREALDTYRFDLAANILYEFTWNQFC
DWYLELTKPVVSNGSEAEQRGTRHTLITVLEALLRLAHPVIPFITETIWQRVKTLTGETA
AALQNESIMLQPFPEYDAALEDTQALNDLEWIKQAITAVRNIRAEMNIAPSKQLDVLLRN
CNADAQRRVLENQSFIERLARLASITLLPAGEKGPLSVTKLVDGAELLIPMAGFIDKDAE
IARLSKEMGKLDAEIASIEGKLSNEGFVARAPEAVVAKERERLAACKEGKVKLLEQQATI
AAL
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggaaaagacaaacagtcatctcgataccgcatacgacccgaaagagatcgaacagaag
ctgtacgatcactgggaaaaccagggttacttcaagccaaacggcgataccagccaggaa
agcttctgcatcatgatcccgccgccgaacgtcaccggcagcctgcacatgggccacgct
ttccagcagaccatcatggacaccatgatccgctaccagcgcatgcaggggaaaaacacc
ctgtggcaggccggtaccgaccatgccggtatcgctacccagatggtggttgagcgcaag
atcgccgcagaagaaaacaaaacccgccatgactatggccgcgacgcgttcatcgacaaa
atctggcagtggaaagcggaatccggcggcaccatcacccgccagatgcgccgtctgggc
aactccgtcgactgggagcgcgagcgcttcaccatggacgaaggcctgtccaacgcggta
cgcgaagtgtttgtccgcctgcacaaagaagatctgatctaccgcggcaagcgcctggtg
aactgggatccgaaactgcgcaccgccatctccgatctggaagtggaaaaccgcgagtcc
aaaggctcgatgtggcacctgcgctacccgctggccgacggcgccaaaaccgccgaaggc
aaagattatctggtggtcgccaccacccgtccggaaaccgtgctcggtgataccggcgtg
gcggtgaacccggaagatccgcgctacaaagaccttatcggcaaagaaatcattctgccg
ctggttggccgccgcatccgcatcgtcggcgacgaacacgccgatatggaaaaaggcacc
ggctgcgtgaaaatcaccccggcgcacgactttaacgactacgaagtcggtaaacgtcac
ggcctgccgatgatcaacatcctgactttcgacggcgatatccgccaggaagcggaagtg
ttcaacacgctcggcgaaatctgcaccgactactgcaacgaaattccggcccagtatcgt
ggcctggagcgtttcgcggcgcgtaaagcggtggttgccgcctttgaagaattgggtctg
ctggaagagatcaaaccgcacgacctgacggtgccttatggcgaccgcggcggcgtggtg
atcgagccgatgctgaccgaccaatggtacgtgcgcactgcaccgctggcgaaagtggcg
gtggaagccgttgagcaaggcgaaattcagttcgtgccgaagcagtacgaaaacatgtac
ttcagctggatgcgcgacattcaggactggtgcatctcccgtcagctgtggtggggccac
cgcattccggcctggtacgacgtgaacggcaaagtctacgttggccgcagcgaagaagaa
gtgcgcagcgaaaacaacctgggcgccgacgtggtgctgacgcaagacgaagacgtgctg
gacacctggttctcttccggcctgtggaccttctctaccctgggctggccagagcagacc
gacgcgctgaaaaccttccacccgaccagcgtaatggtcagcggcttcgacatcatcttc
ttctggattgcgcgcatgatcatgctgaccatgcacttcatgaaggacgaaaacggcaag
ccgcaggtcccgttcaagacggtctacatgaccggcctgatccgcgacgacgaagggcag
aagatgtccaagtcgaaaggcaacgtcatcgatccgctggacatggttgacggcatctcg
ctggaagatctgctggaaaaacgtaccggcaacatgatgcagccgcagctggcggaaaaa
atccgcaagcgcaccgagaagcagttcccgaacggtatcgaaccgcacggcaccgacgcc
ctgcgcttcaccctggcggcgctggcctctaccggccgtgacatcaactgggacatgaag
cgtctggaaggctaccgcaacttctgtaacaagctgtggaacgccagccgctttgtgctg
atgaacgcggaaggtcaagactgcggcttcaacggcggcgagaaagtgctgtcgctggcg
gaccgctggatcctggccgaattcaaccgcacggtgaaggcttaccgcgaagcgctggac
acctatcgtttcgatttggccgccaacattctgtatgaattcacctggaaccagttctgc
gactggtatctggagctgaccaagccggtggtaagcaacggcagcgaagcggaacagcgc
ggcactcgccacacgctgatcaccgtgctggaagccctgctgcgcctggcgcacccggtg
atcccgttcattaccgaaaccatctggcagcgcgtgaaaaccctgaccggcgaaaccgca
gctgctcttcaaaacgaaagcatcatgctgcagccgttcccagagtacgacgccgcgctg
gaagacacgcaggcgctgaacgacctggagtggatcaagcaggcgatcaccgcggtgcgc
aacatccgcgccgagatgaacatcgcgccgagcaaacagctggacgtgctgctgcgcaac
tgcaacgccgatgcccagcgtcgcgtgctggagaaccagagctttatcgagcgtctggcg
cgcctggcatccatcaccctgctgcctgcgggcgagaaaggcccgctctcggtcaccaag
ctggtggacggcgccgaattgctgatccctatggccggctttatcgataaagacgccgaa
atcgcgcgtctgtcgaaagagatgggcaagctggatgcggaaatcgcgtcgatcgaaggc
aagctgtcgaacgaaggctttgtggcgcgcgcaccggaagcggtggtcgccaaagagcgc
gagcgtctggcggcctgcaaagaaggcaaagtgaagctgctggaacagcaggcgaccatc
gccgcgctgtaa

DBGET integrated database retrieval system