KEGG   Serratia plymuthica PRI-2C: Q5A_007635Help
Entry
Q5A_007635        CDS       T04576                                 

Gene name
yfcG_1
Definition
(GenBank) Disulfide-bond oxidoreductase YfcG
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sply  Serratia plymuthica PRI-2C
Brite
Enzymes [BR:sply01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Q5A_007635 (yfcG_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ANS41996
UniProt: A0A1B1KNK1
LinkDB All DBs
Position
complement(1600242..1600949)
Genome map
AA seq 235 aa AA seqDB search
MLDQTQFPITKLWPAQHPERLQLYSLPTPNGVKVSIMLEEIGLPYEAHLIDIGKNETWTP
EFLSLNPNGKIPSIIDPEGPGGKPLPLFESGAILLYLAEKSGQFLPQDPAQRYETIQWVF
FQMAAVGPMFGQLGFFHRFAGREYEDKRPLERYKNESKRLLGVLESRLEGREWIMGEDYT
IADISLLGWVRNLIGFYEARELVEFDSFPRVGQWLERGLARPAVQRGLNIPARNE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcaaactcaatttcccatcaccaaactgtggccggcacagcatccggaacgg
ctgcagctttactcgctgccaacgcctaacggcgtaaaagtctccatcatgctggaggaa
atcggcctgccgtatgaagcgcatctgatcgatatcggcaagaatgaaacctggacgccg
gaatttctgtcgctgaacccgaacggtaaaataccatcaatcatcgatcccgaaggccca
ggcggcaagccgctgccgctgtttgaatccggcgccatcctgctgtatctggcggagaaa
agcggtcaattcctgccacaggatcccgcgcagcgttacgaaaccatccaatgggtattt
ttccagatggccgcggtcggcccgatgttcggccagctcggcttcttccaccggttcgcc
gggcgcgaatacgaagataaacgcccgctggagcgttataaaaatgaatccaaacgcctg
ctcggcgtgctggaaagccgcctcgaaggccgcgagtggatcatgggcgaggattacacc
atcgccgacatttcactgctgggctgggtgcgcaacctgatcggtttctatgaggcgcgc
gaactggtggaattcgacagtttcccacgggtggggcaatggctggagcgcggtttggcg
cgcccggcagtacaacgcggtctgaatattcccgctcgcaacgaataa

DBGET integrated database retrieval system