KEGG   Serratia plymuthica PRI-2C: Q5A_011355Help
Entry
Q5A_011355        CDS       T04576                                 

Gene name
gstB_4
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00480  Glutathione metabolism
sply01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Q5A_011355 (gstB_4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sply02000]
    Q5A_011355 (gstB_4)
Enzymes [BR:sply01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Q5A_011355 (gstB_4)
Transporters [BR:sply02000]
 Other transporters
  Pores ion channels [TC:1]
   Q5A_011355 (gstB_4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 Glutaredoxin2_C GST_C_6
Motif
Other DBs
NCBI-ProteinID: ANS42724
UniProt: A0A1B1KQL4
LinkDB All DBs
Position
complement(2384616..2385221)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLAQKKTESGADYLAINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRNLIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPDE
YKAIVRTRLEQQFNYLDSVLAKQHFLLGNRFSVADAYLFTVLRWAIALQFDLKKHPRLAA
YFDSVAARPAVDAALNAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggcgcctgttcgctgtcaccgcatattgtgctgcgcgag
gcgggcctggattttacggcggaaaaggtcgatctggcacagaaaaagaccgaaagcggt
gcagactacctggccatcaaccctaagggacaagtgccggcgctgttgctggatgatggc
agcctgctgaccgagggtgtggcgattgtgcaatatctggcggatcgcgtgccggaccgc
aacctgatcccggcggcgggtacgctgtcgcgttatcatgccattgagtggctgaactat
attgcgactgaattgcacaagggattcagcccgctgtttaacccgaaaacgccggatgaa
tacaaggccatcgtgcgcaccaggctggagcagcaattcaactatttggattccgtgctg
gcaaagcagcacttcctgttgggaaaccggttcagcgtggcggacgcctatctgtttacc
gttttgcgttgggccatcgccctgcagtttgatctcaaaaaacacccccggttggcggcg
tattttgacagcgtggctgcacggccagcggtagatgcggcgctgaacgccgaaggtttg
aaataa

DBGET integrated database retrieval system