KEGG   Serratia plymuthica PRI-2C: Q5A_012365Help
Entry
Q5A_012365        CDS       T04576                                 

Gene name
bglY
Definition
(GenBank) Beta-galactosidase BglY
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sply00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Q5A_012365 (bglY)
Enzymes [BR:sply01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Q5A_012365 (bglY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Cellulase Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ANS42926
UniProt: A0A1B1KR50
LinkDB All DBs
Position
2605628..2607688
Genome map
AA seq 686 aa AA seqDB search
MNKFPPLSAKVPGLLHGADYNPEQWANYPGMVEKDVELMKQANCNIMSVGIFSWSKLEPE
EGKYQFAWLDEVLNKLYAQGIHVFLATPSGARPAWLSQKYPEVLRVGRNRVPALHGGRHN
HCLSSPVYRRKVNEINLELAQRYAHHPAVIGWHISNEYSGECHCSRCQSDFREWLQQRYQ
TLDRLNEAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFCSSQATDFCAQEIAP
LKAANPDLPATTNFMEYFYDYDYWQMSKVIDFISWDSYPMWHNRQDETALACYTAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPISKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHSGRLDTRVGKEVSELGRLLAAMAPVAGSRVEARVAIIFDWESRWAMDDA
QGPRNAGLHYEQTVVEHYRPFWEQGIAVDIINADCDLSGYQLVIAPMLYMVREGFAARAE
AFVRQGGQFVASYWSGIVNESDLCHLGGFPGPLRPLLGIWAEEIDSLTDDETNSIRGVPG
NELGLQGSYQARHLCELINLEGASAQAVYGGDFYAGRPALTVNRFGDGKAWYVASRNDAS
FQRDFFMAIAQELALPRALHTLLPPGVTAQRRTDGESEFIIVQNYSDKAKTVELPAVYVD
MSDAGTLQGEMALAPWGCRILTRKLA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttcctcctttgagtgcaaaggtgcctggcctattgcatggagcagactac
aatccggaacaatgggctaattatccgggtatggtggagaaagatgtagagctgatgaag
caggctaactgcaatattatgtcggtggggatattcagctggtcgaaacttgaacctgaa
gagggtaaatatcaattcgcctggttggatgaggtgctgaataagttatatgcgcagggt
attcacgtatttttggctacgccaagcggcgcgcggccggcgtggttgtcgcaaaaatac
ccggaggtgctgcgcgtggggcgcaatcgggtaccggcgttgcacggcggccgacacaac
cattgcctgtcatccccggtatatcgccgcaaggtgaatgagatcaacctggaattggcg
cagcgttatgcgcaccacccggcggtgatcggctggcatatttccaacgaatacagcggc
gaatgccattgcagccgttgccagagcgatttccgcgaatggctgcagcaacgttatcag
acgctggataggctgaacgaggcctggtggagcgatttctggagccacacctacagcgac
tggtcgcagattgaatcgcctgcgccgcagggtgaggtgtcgattcacggtctgaacctg
gactggcggcgtttttgcagcagccaggccaccgatttttgcgcgcaggaaattgcgccg
ctgaaggcggccaatccggacttgccggccaccaccaactttatggaatatttctacgat
tacgattactggcagatgtcgaaagtcatcgatttcatctcctgggacagctacccgatg
tggcataaccggcaggacgaaaccgcgctggcctgctataccgccatgttccacgacctg
atgcgcagcctgaaacagggcaagccttttgtgctgatggaatcgacgccgagcgtcacc
aactggcagccgatcagcaagctgaagaagccgggtatgcatattctctcctcattgcag
gcggtcgcgcacggtgcggattcggtacagtacttccagtggcgcaaaagccgcggctcg
gtggagaagttccacggcgcggtgattgaccactccgggcggctggatactcgcgtcggc
aaagaggtgagcgaactgggccggttgctggccgccatggcaccggtcgccggtagccgg
gtcgaggcgcgggtggcgattatcttcgattgggaaagccgctgggcgatggacgatgcg
caagggccgcgcaacgccgggctgcattatgaacagacggtggtggagcattatcgtccg
ttctgggagcagggcatcgcggtggatatcattaacgccgattgcgacctgtctggctat
cagctggtcattgcgccgatgctgtatatggtgcgcgaaggctttgccgcgcgggcggaa
gcctttgtccggcagggcgggcagtttgtcgccagctactggagcggcatcgtcaatgaa
agcgatctgtgccatctgggcggtttcccggggccactgcggccgttgctggggatctgg
gcagaggagatcgacagcctgacggatgacgaaaccaacagcattcgcggtgtgccgggc
aacgagctgggcttgcagggcagctatcaggcgcgccacctgtgcgagctgatcaacctg
gaaggcgccagcgcgcaggcggtctacggcggtgatttctatgccggccgcccggcgttg
acggtcaaccgctttggcgacggcaaggcgtggtacgtcgcttcgcgcaacgatgcctct
ttccagcgcgatttctttatggcgatagcgcaagagctggcgttgccgcgcgcgctgcac
accctattgccgccgggcgtgaccgcacagcggcgcaccgacggcgagtccgagtttatt
atcgtgcaaaactacagcgacaaggcaaaaaccgtcgagttgccggcggtgtatgtcgat
atgtcggatgcgggtaccttgcagggcgaaatggctctggcaccctggggctgccgcata
ttgacccgcaagttggcatag

DBGET integrated database retrieval system