KEGG   Serratia plymuthica PRI-2C: Q5A_013785Help
Entry
Q5A_013785        CDS       T04576                                 

Gene name
dacD
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase DacD
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00550  Peptidoglycan biosynthesis
sply01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q5A_013785 (dacD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sply01002]
    Q5A_013785 (dacD)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sply01011]
    Q5A_013785 (dacD)
Enzymes [BR:sply01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Q5A_013785 (dacD)
Peptidases [BR:sply01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Q5A_013785 (dacD)
Peptidoglycan biosynthesis and degradation proteins [BR:sply01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Q5A_013785 (dacD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ANS43210
UniProt: A0A1B1KRZ8
LinkDB All DBs
Position
complement(2920602..2921771)
Genome map
AA seq 389 aa AA seqDB search
MKRSVLSVITGIWLPLAVQAADTPLSFPLNTPPAIDAASYVLMDYTTGQVLAENNADERR
NPASLTKLMTGLVIDHALDQHKIGLDDVVTVGKDAWAQGNPVFKGSSLMFLKPGDRVTVR
DLSRGIIIDSGNDACVAMADYVAGSQAAFVKLMNEKSVQLGLQNTHFETVHGLDAPGQFT
TAGDLALISRAIIMSEPAEYHMYSEKSLSWNGITQQNRNGLLWDKNLRVDGLKTGHTESA
GFNIIASATEGDRRLIAVVMGGKSAKGREDQARKLLTWGLRDFATVHLFSAGQTLGQEKV
WYGDRHLVPVGSEQDQYLSLPKREADKLKAQYVITPSRLDAPLTKGQPIGEIRISDNGNL
LKTLPLVALQPVNNGGMFSRLMDYVKLKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgttcagtattgtctgtgataaccggaatttggctgccgttggcggtacaggcg
gcggatacgccactcagttttcctctcaatacaccgccggcgatagacgcggcttcttac
gtattgatggattacaccaccggtcaggtactggcggagaacaatgcggacgagcggcgc
aatccggccagcctgaccaaactgatgaccggattggtgattgatcatgcgctcgatcag
cacaaaattggcctggatgacgtggtgaccgtgggcaaagacgcctgggcgcagggcaat
ccggtgttcaagggatcctcgctgatgttcctgaaacccggtgacagggtcacggtgcgt
gatctcagtcgcggcattattattgactccggcaacgatgcctgcgtggcgatggcggac
tacgtggcgggcagccaggccgcgttcgtcaaactgatgaatgaaaaaagcgttcagctt
ggcctgcaaaatacccattttgaaaccgtccacgggctggacgcgccaggccagttcact
acggccggcgatctggcgttgatttcgcgtgccatcatcatgagcgaaccggcggaatat
catatgtacagcgaaaaatcgctgtcctggaacgggattacccaacagaaccgcaatggg
ctgctgtgggataaaaacctgcgggtagacggcctgaaaacgggccataccgaatcggcc
ggttttaacattattgcctccgcgaccgaaggcgaccggcgtttgattgctgtcgtgatg
ggcggtaaaagcgccaaagggcgagaagatcaggcccgtaaactgctgacctggggtctg
cgagatttcgccaccgtgcatctgtttagcgcagggcaaactctggggcaggaaaaagtg
tggtatggcgatcgccatctggtgccggtgggcagcgagcaggatcaatacctcagcttg
ccaaagcgcgaggcggacaagttgaaagcccagtatgtgataaccccttcgcgtcttgac
gccccgctgacaaagggacagccgattggggagatccgcatcagcgataacggcaatcta
ttgaaaaccctgccgctggtggcgctgcagccggtaaacaacggcggtatgttctcgcgc
ctgatggactatgtgaagctgaaactctga

DBGET integrated database retrieval system