KEGG   Serratia plymuthica PRI-2C: Q5A_017820Help
Entry
Q5A_017820        CDS       T04576                                 

Gene name
fadJ
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00071  Fatty acid degradation
sply00280  Valine, leucine and isoleucine degradation
sply00281  Geraniol degradation
sply00310  Lysine degradation
sply00362  Benzoate degradation
sply00380  Tryptophan metabolism
sply00410  beta-Alanine metabolism
sply00640  Propanoate metabolism
sply00650  Butanoate metabolism
sply00903  Limonene and pinene degradation
sply00930  Caprolactam degradation
sply01100  Metabolic pathways
sply01110  Biosynthesis of secondary metabolites
sply01120  Microbial metabolism in diverse environments
sply01130  Biosynthesis of antibiotics
sply01200  Carbon metabolism
sply01212  Fatty acid metabolism
Module
sply_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Q5A_017820 (fadJ)
   00650 Butanoate metabolism
    Q5A_017820 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q5A_017820 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q5A_017820 (fadJ)
   00310 Lysine degradation
    Q5A_017820 (fadJ)
   00380 Tryptophan metabolism
    Q5A_017820 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q5A_017820 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q5A_017820 (fadJ)
   00281 Geraniol degradation
    Q5A_017820 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q5A_017820 (fadJ)
   00930 Caprolactam degradation
    Q5A_017820 (fadJ)
Enzymes [BR:sply01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Q5A_017820 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Q5A_017820 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Q5A_017820 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ANS44004
UniProt: A0A1B1KU92
LinkDB All DBs
Position
complement(3772478..3774643)
Genome map
AA seq 721 aa AA seqDB search
MSFENALHEQRAKPSAFQLTLRPDNIGVITIDVPGDKVNTLKAEFVEQVNDVLIRAQQHT
ALEGLVIISGKPDSFIAGADITMIAACTSAKEAETLAKKGQSTLAQIAAFPVPVVAAIHG
ACLGGGLELALACHGRICSLDDKTALGLPEVQLGLLPGSGGTQRLPRLIGASKALDMMLT
GKHIRARQALRMGLVDDAVPQAILLQTAIERVKQGWQSRRELPWQERLLNGPLGKSLLFS
IVRKKTLEKTHGNYPAAEKIIQVVRTGLDLGSTSGYEAEARAFGELAMTPKSAALRSLFF
ASTALKKERGGNAQPHALHRVGILGGGLMGGGIACVTATRGGLPVRIKDVNETGINHALK
YSWDVLGKRVRSKRMRPAERQKQMMLISGSTDYTGFERVDIVVEAVFEDLALKQKMVAEI
EQHAAPHTIFASNTSSLPIGQIAANAQRPQQVIGLHYFSPVDKMPLVEVIPHASTSEETI
ATTVALARKQGKTAIVVADRAGFYVNRILAPYINEAARCLLEGEPVESLDKALVDFGFPV
GPITLLDEVGIDVGTKIIPVLVEQLGPRFAAPVAFDAVLKDGRKGRKNGRGFYLYPSEGQ
QRQRGKRADTSVYLLLGITPKSHLQPAVIAQRCVMMMLNEAARCLDEGVIRSARDGDIGA
VFGIGFPPFLGGPFRYMDELGAEKVVKTLHYLQQQYGENFAPCERLQRMAQQGERFYPSG
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgaaaacgcattgcatgagcagcgggccaaaccctcggcgtttcaattgacg
ttgcgcccggacaacattggtgtgattaccatcgacgtcccgggcgacaaggtgaacacg
ctgaaagccgagttcgtcgagcaggtgaatgacgtactgatccgtgcgcagcagcatacc
gcgctggaagggctggtgattatttccggtaagccggattcgtttattgccggggcggac
atcaccatgatcgccgcctgcaccagcgccaaagaggccgaaacgctggcgaaaaaaggg
caaagcacactggcgcagatcgccgctttcccggtgccggtggtggcggctattcacggc
gcttgcctggggggcgggctggaactggctctggcctgccatggccgcatctgttcgctg
gatgacaaaaccgctctcggcctgccggaagttcagcttggcttgttgccaggctccggc
ggcacccagcgattgccgcgcttgatcggtgccagcaaggcgctggacatgatgctgacc
ggcaaacatattcgcgcgcgtcaggcgttgcggatgggtttggtggatgatgcggtgccg
caggcgattttgttgcagaccgccattgaacgggtcaaacaggggtggcaaagccggcgc
gaactgccgtggcaggagcgcttgctcaacggccctctgggaaaaagcctgttgttcagc
attgtgcgcaaaaaaacgctggagaaaacccacggcaactatccggcggcggaaaaaatc
attcaggtggtgcgtaccggcctggatctcggtagcaccagcggttatgaagccgaggcg
cgagcctttggcgaactggccatgacgccgaagtcggcggcgttgcgcagcctgttcttt
gcctctaccgccttgaagaaagagcgcggcggcaatgcgcaaccccatgcgttgcaccgc
gtcggtattttgggcggtggcctgatgggcggcggtattgcctgcgtgaccgccacgcgc
ggcggcctgccggtgcgaattaaagatgtcaatgaaaccggcatcaaccacgcgctgaaa
tacagctgggatgtgctcggcaagcgcgtgcgcagcaaacgcatgcgcccggcggaacgg
caaaaacagatgatgctgatctccggttcgaccgattacaccggctttgagcgcgtggat
atcgtggtggaggcggtgtttgaggatctggctctgaagcagaaaatggtggccgagatt
gaacagcacgccgcacctcataccattttcgcctccaatacctcgtcgttgccgattggc
cagattgccgccaatgcgcagcggccgcagcaggtgatcggcctgcattatttcagcccg
gtcgacaaaatgccgttggtcgaggtgatccctcatgcttccaccagtgaggaaaccatt
gccaccaccgtggcgctggcgcgcaaacagggcaagacggcgatcgtggtcgccgatcgc
gccggtttctacgtcaaccgtattttggctccttatataaatgaagcggcgcgttgcctg
ctggaaggtgaacccgtcgaatcgctggacaaggcgctggtggattttggcttcccggtg
gggccgattaccctgctcgatgaagtgggcattgatgtggggaccaagattatcccggtg
ctggtggaacagctcgggccgcgttttgccgcgccggtcgcctttgatgcggtgctgaaa
gacgggcgcaaggggcgcaaaaacggcaggggtttctacctgtatccaagcgaaggtcag
caacgccagcggggcaagcgcgccgatacctcggtctatcttctgctgggcattacgccg
aagtcgcatttgcagccggcggtcatcgcccagcgctgcgtcatgatgatgttgaatgaa
gcggcgcgttgcctggacgaaggcgtgatccgcagcgcgcgtgatggggatatcggcgcg
gtattcggcattggtttcccgccattcctcggggggccgttccgttatatggacgaactc
ggcgctgagaaggtggttaaaacactgcactacctgcagcagcaatacggcgaaaacttt
gccccctgcgaacgcttgcagcgcatggcgcagcagggcgaacgcttctatccgtcaggg
gagtga

DBGET integrated database retrieval system