KEGG   Serratia plymuthica PRI-2C: Q5A_019945Help
Entry
Q5A_019945        CDS       T04576                                 

Gene name
fabZ_3
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00061  Fatty acid biosynthesis
sply00780  Biotin metabolism
sply01100  Metabolic pathways
sply01212  Fatty acid metabolism
Module
sply_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Q5A_019945 (fabZ_3)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Q5A_019945 (fabZ_3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sply01004]
    Q5A_019945 (fabZ_3)
Enzymes [BR:sply01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Q5A_019945 (fabZ_3)
Lipid biosynthesis proteins [BR:sply01004]
 Fatty acid synthase
  Component type
   Q5A_019945 (fabZ_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ANS44415
UniProt: A0A1B1KVF7
LinkDB All DBs
Position
complement(4229792..4230247)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLDIAEILELLPHRYPFLLVDRVLDFEEHKFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVATVDGKIVCEATMMCARSRES
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctggatattgcagaaattttggagttgcttcctcaccgt
tacccgttcttgctggtcgatcgcgtccttgattttgaggagcacaaattcctgcgtgcg
gtgaagaacgtatctgtaaatgagccgtttttccaggggcatttccctggcaagccgatt
tttccaggcgtattgattctggaagcaatggcgcaggccaccggtattctggcgtttaaa
agcgtcggcaagctggagccgggcgaattgtattactttgccggtatcgacgaagcccgt
ttcaaacgaccggtagtgccaggcgatcagatgatcatggaagtcacctttgagaaaact
cgtcgcggtctgacgcgcttcaaaggcgtagcaaccgttgacggcaaaattgtttgcgaa
gcaaccatgatgtgtgcgcgcagccgggagtcttaa

DBGET integrated database retrieval system