KEGG   Serratia plymuthica PRI-2C: Q5A_022450Help
Entry
Q5A_022450        CDS       T04576                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00250  Alanine, aspartate and glutamate metabolism
sply00410  beta-Alanine metabolism
sply00640  Propanoate metabolism
sply00650  Butanoate metabolism
sply01100  Metabolic pathways
sply01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sply00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Q5A_022450 (puuE)
   00650 Butanoate metabolism
    Q5A_022450 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Q5A_022450 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Q5A_022450 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sply01007]
    Q5A_022450 (puuE)
Enzymes [BR:sply01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Q5A_022450 (puuE)
Amino acid related enzymes [BR:sply01007]
 Aminotransferase (transaminase)
  Class III
   Q5A_022450 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANS44906
UniProt: A0A1B1KWT1
LinkDB All DBs
Position
complement(4810774..4812039)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGIGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIERQLKAFTHTAYQIVPYESYVSLAERINQRAPIEGPCKTALFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNIAPADFMQALRELCDQHGILLIADEV
QTGFARTGKLFAMEHYAVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIDEEQLCQRSQRLGQHLVEVLQQARTTSPAIADIRAQGSMVAVEFKD
PATGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEEQFTQALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaactgaatcaacgtcgccaggatgccaccccacgcgggattggcgtg
atgtgcggtttttacgccgagcgtgcggagaacgccacgctgtgggacgtagaaggcaat
gaggttatcgatttcgcttccggtattgctgttctgaatacaggacaccggcatccgaag
gtgatcgccgccattgaacggcaactgaaggccttcacccacaccgcttatcagattgtt
ccctacgaaagctacgtctcgttggcagagcgtatcaaccagcgcgcaccgatagaaggc
ccttgcaaaaccgccttgttcaccaccggcgccgaagcggtggaaaacgcggtcaaaatc
gcccgcgcctataccggccggccgggcctgatcacctttggcggcggtttccatggccgc
acttacatgaccatggcgctgaccggcaaagtggcgccttacaagctgggcttcgggccc
ttccccggttcggtgttccacggtcagtaccctaatgcgctgtatggcgtgaccaccgaa
gacgcgatgaacagcctggagcgcatctttaaggcggatatcgatcccaaacaagtggcc
gccatcgtgctggagccggtgcagggcgagggcggtttcaacatcgcgccggccgatttt
atgcaggcgctgcgcgaactgtgcgaccagcacggcattttgctgattgccgacgaagtg
cagaccggttttgcccgtaccggcaagctgtttgccatggagcattacgcggtgaaaccg
gatctgatcaccatggcgaaaagcctggcgggcggtatgccactgtcggcggtggccggc
cgtgcagaggtgatggatgccccggcgccgggcgggctgggcggcacctatgccggtaac
ccgctggcggtggccgcggcactggcggtgctggacgtgattgacgaagaacagctgtgc
cagcgttcccaacgtttgggccagcatttggtagaagtgctgcaacaggcacgtacaacc
agcccggcgatcgcggatattcgcgcgcagggatcgatggtggcggtggagttcaaggat
ccggcgaccggcaagccttcggcggagatcacccgtcaggtacagcagaaggcgctggaa
gagggcctgctgctgttgagctgcggtgtgaacggcaacgtgatccgcttcctgtatccg
ctgaccatccctgaggagcagttcacccaggcgctgggcattctttcccgcgcgttggcc
caataa

DBGET integrated database retrieval system