KEGG   Serratia plymuthica PRI-2C: Q5A_023120Help
Entry
Q5A_023120        CDS       T04576                                 

Gene name
yfcG_3
Definition
(GenBank) Disulfide-bond oxidoreductase YfcG
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sply  Serratia plymuthica PRI-2C
Pathway
sply00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:sply00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Q5A_023120 (yfcG_3)
Enzymes [BR:sply01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Q5A_023120 (yfcG_3)
Transporters [BR:sply02000]
 Other Transporters
  Pores ion channels [TC:1]
   Q5A_023120 (yfcG_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ANS45038
UniProt: A0A1B1KX74
LinkDB All DBs
Position
complement(4952923..4953591)
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNNSRSQRILWFLEELGVPYQVQRYQRDPQTMLAPPELKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGLFIPTDHHARQQYRYWLHYAEGSLMPLQVMKLVFGRLGQ
PPIPWLLRPVAGAIGKGVQREYLDKQIATHRDYLEQHLSKSTWFVGNEFSAADIQMSFPL
EVMAARGSLDGCPKLRGYLQRIHTRPAYQRALEQGGPYELLS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtgcaccatctgaataactcacgctcgcagcgtatcttgtggtttctggaa
gaactgggtgtgccttatcaggtgcagcgttaccaacgcgatccgcaaaccatgctggct
ccaccggagctgaaaaagatccacccgctgggcaaatctccggtgattgtcgatggcgat
ctgaccctggcggaatccggcgccattatcgaatatttgcaagaagcctacgatgcccag
gggctgtttatcccgaccgaccaccatgcccgccagcaatatcgttactggctgcattat
gcggaaggatcgctgatgccgctgcaggtcatgaagctggtgttcggtcgcctgggacaa
ccgccaatcccctggttgttgcgaccggtggcgggggcgattggcaaaggggttcagcga
gaatatctggacaaacagatcgccacgcatcgcgactatctcgagcagcacctgagcaaa
agcacctggtttgtcggcaatgagttcagcgcggcggatatccagatgagcttcccactg
gaagtgatggcggcacgcggctcgctggacggttgcccgaagctgcgtggctatctgcaa
cgtatccatacccggccggcctaccaacgggcgctggagcagggcggcccttatgaactg
ctgagctga

DBGET integrated database retrieval system