KEGG   Streptococcus pyogenes MGAS8232 (serotype M18): spyM18_1849Help
Entry
spyM18_1849       CDS       T00079                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spm  Streptococcus pyogenes MGAS8232 (serotype M18)
Pathway
spm00220  Arginine biosynthesis
spm00250  Alanine, aspartate and glutamate metabolism
spm00290  Valine, leucine and isoleucine biosynthesis
spm01100  Metabolic pathways
spm01110  Biosynthesis of secondary metabolites
spm01130  Biosynthesis of antibiotics
spm01210  2-Oxocarboxylic acid metabolism
spm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    spyM18_1849
   00290 Valine, leucine and isoleucine biosynthesis
    spyM18_1849
   00220 Arginine biosynthesis
    spyM18_1849
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spm01007]
    spyM18_1849
Enzymes [BR:spm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     spyM18_1849
    2.6.1.66  valine---pyruvate transaminase
     spyM18_1849
Amino acid related enzymes [BR:spm01007]
 Aminotransferase (transaminase)
  Class I
   spyM18_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AAL98362
LinkDB All DBs
Position
complement(1524862..1526076)
Genome map
AA seq 404 aa AA seqDB search
MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPDEVIRDLIV
NARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISMSLQALLDNGD
EVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAIVVINPNNP
TGALYLKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGGHQSVDALL
LPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFVLQLLKQEK
VMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattgaaaaatcatcaaaattagaacatgttgcctatgatattcgagggcct
gttttggatgaagctaatcgcatgattgcgagtggtgaaaaaattctgcgtttaaatact
ggcaatcctgctgcctttggttttgaagcaccagatgaagtgattcgtgatttaattgtc
aacgcgaggctaagtgagggctattctgacagtaaagggattttttcagcgcgtaaggct
atcatgcagtattgccaactcaagggcttcccagatgttgacattgaagatatttatttg
ggaaatggcgtgtcagagttgatatccatgtcccttcaagctttgctagataatggcgat
gaagttttagtaccaatgccggattatcctttatggacggcttgtgtgagtcttggtgga
ggaaaagcagtccattatctttgtgatgaagaagctggttggtatcctgatattgctgat
atcaaatcaaaaatcacgagtcgcaccaaagctattgtggtcatcaatcctaataaccca
acaggagccctttatcttaaggagattttagaagacatcgttgctttggcaagagaacac
cagctgattatttttgccgatgaaatctatgatcgtttggtgatggatggtaaagagcat
attgctattgcaagtttggcacctgatgttttttgtgtatctatgaatggcctttccaaa
tctcatcgtattgctggttttcgtgttggatggatggtcttatcaggtcctaaagaccat
gttaaaggttacattgaagggttgaacatgcttgccaatatgcggttatgctccaatgtt
ttagctcaacaagttgttcaaacttccttaggaggccatcaatcagttgatgcactgtta
ctgccaggagggcgtatttttgagcaacgtaattttatttatgaagctattaatgctatc
cctggcttatcggcagttaaacctgaagcaggtctttatttatttccgaaaattgatcgt
cagatgtatcgtattgatgatgatgaagaatttgtcttacagttattaaagcaagaaaaa
gtgatgttggtacatggacgtggttttaactggaaagatccagatcacttccgtattgtt
tacctaccaagtgtagaagaattagaagatgttcaagaaaagattacacgtgtcttatac
cagtatagacgttaa

DBGET integrated database retrieval system