KEGG   Sphingobium sp. MI1205: K663_11250Help
Entry
K663_11250        CDS       T04383                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spmi  Sphingobium sp. MI1205
Pathway
spmi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:spmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    K663_11250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spmi02000]
    K663_11250
Enzymes [BR:spmi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     K663_11250
Transporters [BR:spmi02000]
 Other Transporters
  Pores ion channels [TC:1]
   K663_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMK18630
UniProt: A0A126R8H0
LinkDB All DBs
Position
1:2334686..2335315
Genome map
AA seq 209 aa AA seqDB search
MPADISLYTNPMSRGQIARWMLEEVGQPYETVVLDYSDGMKSADYLAINPMGKVPAIVHR
GAVVTEAAAICAYLADAFPEAGLAPPPAKRADYYRWLFFAAGPVEAAVTNRALGFVVPEG
RDRMAGYGTFDHTVDALERAVSVPAWICGDQFTAADVYVGAQVDWGLAFGTMPSRPAFEA
YASRLRERPAYKRQKELDGALIAQMEKSE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagacatctctctttacaccaaccccatgtcgcgcggacagatcgcccgctgg
atgctggaggaagtcggtcagccctatgaaacggtagtgctggattacagcgacggcatg
aaatccgccgactatctggcaatcaatccgatgggcaaggttcctgctatcgtccatcgt
ggcgcggttgttaccgaagcggcggccatctgcgcctatctggcggacgcttttccggag
gccggacttgcaccacctcccgccaaaagagccgattactaccgctggctctttttcgcc
gcgggcccggtggaagcagccgtcaccaacagggcgctcggtttcgtcgtgcccgagggg
cgcgaccgcatggcgggctatgggacattcgatcataccgtcgatgcactggaacgcgcg
gtttcagtaccggcatggatttgcggcgatcagttcacggcggccgatgtgtatgtgggc
gcccaggtggattggggcctggccttcggcaccatgccatcgcgaccggctttcgaggca
tatgccagccgcctgcgcgaacgcccggcctacaaacggcaaaaggaactggatggcgcg
ctgatcgcccagatggagaagtccgaataa

DBGET integrated database retrieval system