KEGG   Sphingobium sp. MI1205: K663_12050Help
Entry
K663_12050        CDS       T04383                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spmi  Sphingobium sp. MI1205
Pathway
spmi00473  D-Alanine metabolism
spmi00550  Peptidoglycan biosynthesis
spmi01100  Metabolic pathways
spmi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spmi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    K663_12050 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    K663_12050 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    K663_12050 (ddl)
Enzymes [BR:spmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     K663_12050 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:spmi01011]
 Precursor biosynthesis
  Amino acid ligase
   K663_12050 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AMK18789
UniProt: A0A126R9N5
LinkDB All DBs
Position
1:complement(2473194..2474153)
Genome map
AA seq 319 aa AA seqDB search
MSRGPWHVAVLMGGWSAERPVSLSSGEGVAKALESRGHKVTRIDMDRHVAARLAEADADV
VFNALHGVPGEDGTVQGMMDLMGITYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGHVV
TSASLFDADPMPRPYVVKPVNEGSSVGVAIVMPEGNYGFPIGRDVEGPWQHFDELLAEPY
IRGRELTTAVLGEEALLVTELRPKSGFYDFDAKYTDGMTEHVCPADIPSEISEACKAIAL
RAHRLLGCRGASRSDFRWDDTQGVEGLYLLEVNTQPGMTPLSLVPEQAAKLGIDYPELVE
RIVEDALKQKQGAKGAGNG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtggcccctggcatgttgccgtcctgatgggtggctggtccgccgagcggccc
gtatccctgtcgagtggcgaaggcgtggccaaggcgctggaatcgcgcgggcacaaggtg
acgcggatcgacatggatcgtcatgtcgccgcccgcctcgcggaagctgatgccgatgtc
gttttcaatgccctccacggcgttcccggcgaagatggcacggtgcagggcatgatggat
ctgatggggatcacctatacgcatagcggcctcgctacctcggtcatcgccatcgacaag
caactgaccaaacaggcgctggtgccccatggcattcccatgcccggcggtcatgtcgtg
accagcgcaagcctgttcgacgcagatccgatgccacgcccctatgtggtgaagccggtc
aatgaaggcagttcggtaggcgtggccatcgtcatgccggagggtaattacggttttcct
attggccgcgatgtggaagggccctggcagcatttcgatgaactgctggccgaaccctat
attcggggccgcgaactgacgaccgccgtgctgggtgaggaggcgttgctggtcaccgaa
ctgcggcccaaaagtggcttctatgattttgacgccaaatataccgacggcatgaccgaa
catgtctgcccggcggacatccccagcgaaatcagcgaggcatgcaaggcgatcgccctt
cgcgcgcaccggctgctgggatgccggggggcgtcgcgctccgacttccgctgggatgat
acgcagggtgtcgaagggctgtacctgctggaggtcaacacccagccgggcatgacgccc
ctgagcctggtgccggaacaggcggcgaaactcggcattgactatcccgaactggtcgag
cgtattgtcgaagatgcgctgaagcagaagcagggcgcaaagggggcaggcaatggctga

DBGET integrated database retrieval system