KEGG   Sphingobium sp. MI1205: K663_16821Help
Entry
K663_16821        CDS       T04383                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spmi  Sphingobium sp. MI1205
Pathway
spmi00620  Pyruvate metabolism
spmi00680  Methane metabolism
spmi01100  Metabolic pathways
spmi01120  Microbial metabolism in diverse environments
spmi01200  Carbon metabolism
Module
spmi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    K663_16821
  09102 Energy metabolism
   00680 Methane metabolism
    K663_16821
Enzymes [BR:spmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     K663_16821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase ACT_5
Motif
Other DBs
NCBI-ProteinID: AMK19725
UniProt: A0A126RDS7
LinkDB All DBs
Position
2:66352..69048
Genome map
AA seq 898 aa AA seqDB search
MATPVSSTPPVTQNPDIRYLGRLLGDVIRAYGGDRLYRQTEYIRSASVDRARGIHGVDVV
DTGLEALSLDDTLSFVRGFMLFSMLANLAEDRQGVAADPDADVESAIERLASHGIDRDAV
LALLNNALIVPVLTAHPTEVRRKSMIDHKNRIADLMLLKDAGRSETDEGEDLDEAIARQI
ALLWQTRPLRRQKLFVQDEIDNVLTYFRDVFLPVLPALYARWERVLGVRPPSFLRVGNWI
GGDRDGNPFVQAPQLRSALARGCEAAVGYYLDALHALGAELSLSTELAHVPDGVLALAEA
SGDTSPSRQDEPYRRAISGIYARLAATYRTMVGHEPPRPSRLTGEPYAQPGDLRRDLVTV
AQGLAGEGDGALATGGALGRLIRAVETFGFHLATLDMRQNSDVHERVVTELLKVAGVQDD
YAALDEYARIALLRRELASNRPLGTRFSEYSEETASELAIVQAAADAHRIYGPACISHYI
ISKAESVSDLLEVNLLLKEAGLWRTGKDNAPAQAAIMAVPLFETIADLEAAPSIMAAYFG
LPEIAGVVRERGHQEVMIGYSDSNKDGGYMTSTWSLYQASKALAPVFERAGTAMQLFHGR
GGAVGRGGGSSFAAIQAQPKGTVQGRIRITEQGEVIAAKFGTRDVAMTNLEAMTSATLLA
SLEPQGISDRDAARFTAAMDELSKSAFSAYRDLVYGTEGFKEFFRQLTPIQEISGLKIGS
RPASRTKSTRIEDLRAIPWVFSWSQARVMLPGWYGMGQAFEAFGDKALLADMAQCWSFLQ
SALANLEMVLAKSDLGIAAHYLPLVEDQAVGGAIFDRIRQGWELTHDGLLAATGQSRLLE
KNPKLDESIRLRLPYIEPLNLLQVELMKRHRGGEDDPRVKEGIELSINAIATALRNSG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcctgtatcctctactccgcccgtcacgcaaaatcctgacatccgttatctc
ggacgcctgttgggcgatgtgatccgggcctatggcggggacaggctgtaccggcagacg
gaatatatccggtcggcatcggtcgatcgggcgcgcggcatccacggggtggatgtggtc
gataccgggctggaggcgttgagcctggacgatacgctatccttcgtacgcggcttcatg
ctgttttcgatgctggccaatctggccgaggatcggcagggcgtggcggcagatcctgac
gccgatgtcgaatccgccatagagcggctggcgtcgcacgggatcgatcgggatgcggtg
ctcgcgctgctcaacaatgcgctgatcgtgccagtgctgaccgcccacccgaccgaggtg
cggcgcaagagcatgatcgaccacaagaatcgcatcgccgacctgatgctgttgaaggat
gcggggcgcagcgagaccgatgagggcgaggatctggacgaggcgattgcccggcagatc
gcgctgctgtggcaaacccggcctttgcggcggcaaaagctgttcgtgcaggacgagatc
gacaatgtcctgacctatttccgggacgttttcctgccggtcctgcctgcgctctacgcc
cggtgggagcgcgtgttgggcgtgcggccgcccagtttcctgcgcgtgggcaactggatc
ggtggggaccgggacggcaatccctttgtccaggccccgcaattgcggtctgcattggcg
cgcggatgcgaggcggcggtcggctattatctcgacgcgctgcacgcattgggtgcggaa
ttgtcgctttcgaccgaactggcgcatgtgccggacggcgttctggcgttggctgaggcg
agcggcgacacatcgcccagccgacaggatgaaccctatcgccgcgcgatttccggcatc
tatgcccggctggcggcgacatatcgcacgatggtcgggcatgaaccgccacggccttcc
cggttgacgggcgaaccctatgcgcagccgggcgacctgcggcgggatctggtcaccgtg
gcgcaggggctggcgggcgagggggacggcgcgctggcgaccggcggggcgctggggcgc
ttgatccgggcggtggagacgttcggctttcatctcgcgacgctggacatgcggcagaat
agcgatgtgcatgagcgggtcgttaccgaactgctgaaggtcgcaggagtgcaggacgat
tatgcggcgttggacgaatatgcgcgcatcgccctgctgcggcgggaactggcgagcaat
cgtccgctgggtacgcgcttttcggaatattcggaggagacggcgtcggagctggcgatc
gtgcaggcggcggcggacgcgcaccgcatctacggcccggcgtgcatcagccactatatc
atttcaaaggcggaaagcgtttcggacctgctggaggtcaacctgctgctgaaggaagcg
ggcctgtggcgcacgggcaaggacaatgcgcccgcgcaggcggcgatcatggccgtgccg
ctgttcgagaccatcgccgaccttgaggccgcgcccagcatcatggccgcctatttcgga
ctgccggaaatagccggtgtcgtccgggaacgcggtcatcaggaagtgatgatcggctat
tccgatagcaacaaggatggcggctacatgacatcgacctggtcgctataccaggcgagc
aaggcgctggcgccggtgttcgaaagggcggggacggcgatgcagctgttccatggccgt
ggcggtgcggtcgggcgcggcggcgggtcatcctttgccgcgatccaggcgcagcccaag
ggcacggtgcagggacgcatccgcatcaccgaacagggcgaggtgatcgccgccaagttc
ggcacgcgcgatgtggcgatgaccaatctggaggcgatgacgagcgccacgctgctcgcc
agcctggagccacagggtatttcggaccgggatgcggcgcgcttcaccgcggcgatggac
gagttgtcgaaaagcgccttttccgcctatcgcgaccttgtctacggcacggaagggttc
aaggaatttttccgccagctgacgccgatacaggagatttcaggcctgaagatcgggtcg
cggcccgcaagccggaccaagagcacgcggatcgaggatttgcgcgcgattccctgggtg
ttcagctggtcgcaggcgcgcgtgatgttgccgggctggtacggcatgggacaggcgttc
gaggcgttcggtgacaaggcgctgctggccgacatggcgcaatgctggtccttccttcag
tcggcgctggccaatctggagatggtgttggcgaagtcggacctggggattgccgcccat
tatctgccgctggtcgaggatcaggcggtcggtggggcgatattcgaccggatccggcaa
ggttgggaactgacccatgacgggctgctggcggcgaccgggcaatcgcggctgctggaa
aagaatcccaagctggacgaatcgatccggctgcgcctgccttatatcgagccgctgaac
ctgctgcaggtagaattgatgaagcggcatcgcggcggcgaggatgacccgcgcgtcaag
gaagggatcgagctgtccatcaacgcgatcgcgacggcattgcgtaatagcggatag

DBGET integrated database retrieval system