KEGG   Sphingobium sp. MI1205: K663_17056Help
Entry
K663_17056        CDS       T04383                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
spmi  Sphingobium sp. MI1205
Pathway
spmi00071  Fatty acid degradation
spmi00280  Valine, leucine and isoleucine degradation
spmi00281  Geraniol degradation
spmi00310  Lysine degradation
spmi00360  Phenylalanine metabolism
spmi00362  Benzoate degradation
spmi00380  Tryptophan metabolism
spmi00410  beta-Alanine metabolism
spmi00627  Aminobenzoate degradation
spmi00640  Propanoate metabolism
spmi00650  Butanoate metabolism
spmi00903  Limonene and pinene degradation
spmi00930  Caprolactam degradation
spmi01100  Metabolic pathways
spmi01110  Biosynthesis of secondary metabolites
spmi01120  Microbial metabolism in diverse environments
spmi01130  Biosynthesis of antibiotics
spmi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    K663_17056
   00650 Butanoate metabolism
    K663_17056
  09103 Lipid metabolism
   00071 Fatty acid degradation
    K663_17056
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K663_17056
   00310 Lysine degradation
    K663_17056
   00360 Phenylalanine metabolism
    K663_17056
   00380 Tryptophan metabolism
    K663_17056
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    K663_17056
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    K663_17056
   00281 Geraniol degradation
    K663_17056
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K663_17056
   00627 Aminobenzoate degradation
    K663_17056
   00930 Caprolactam degradation
    K663_17056
Enzymes [BR:spmi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     K663_17056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AMK19772
UniProt: A0A126RCG0
LinkDB All DBs
Position
2:117918..118697
Genome map
AA seq 259 aa AA seqDB search
MTYETILADQRDAVTLITLNRPQALNALNSQVLKDLSAAFAAYDADPTQRCAVLTGSGEK
AFAAGADIKEMVEKQAADFFLEDFFAGWQTGVVATRKPWIAAVQGFALGGGCELAMMADF
IIAGDTAKFGQPEIKLGVAPGMGGSQRLTRAVGKAKAMEMCLTGRMMDAAEAERSGLVSR
IVPAADLLEEALKTAATIAALPPMAAMVNKEMINIAFEIGLAQGLLTERRLFQILTATED
KKEGMTAFVEKRAGVWKGR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacctatgaaaccattctcgccgatcagcgcgacgccgtcacgctgatcacgctcaac
cggccgcaggcgctgaacgcgctcaacagccaggtcttgaaggatctgagcgctgccttc
gctgcctatgatgccgatccgacccaacgctgcgcggtgctgaccggcagcggtgaaaag
gccttcgcggcgggcgccgacatcaaggaaatggtggaaaagcaggcggcggacttcttc
ctggaggacttcttcgccggttggcagaccggggtggtcgccactcgcaagccatggatc
gcggcggtgcaggggtttgcgctgggcggcggatgtgaacttgcgatgatggccgatttc
atcattgcgggcgacacggccaagttcggccagcccgagatcaagctgggcgtggcgccg
ggcatgggcgggtcgcagcgcctgacccgcgccgtgggcaaggccaaggcgatggagatg
tgcctgaccggccggatgatggatgccgccgaagctgagcggtcgggcttggtgagccgc
atcgtgccggccgcagacctgttggaggaagcgctcaagaccgccgcgacgatcgccgcg
ctgccgcccatggccgcgatggtgaacaaggaaatgatcaacatcgcttttgaaataggc
ctggcccaaggattgctgacggagcgccgcttgttccagatcctcacggccaccgaggat
aagaaggaaggcatgaccgccttcgtggaaaagcgcgccggcgtctggaagggccgctga

DBGET integrated database retrieval system