KEGG   Sphingobium sp. MI1205: K663_22113Help
Entry
K663_22113        CDS       T04383                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spmi  Sphingobium sp. MI1205
Brite
Enzymes [BR:spmi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     K663_22113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C
Motif
Other DBs
NCBI-ProteinID: AMK20778
UniProt: A0A126RF20
LinkDB All DBs
Position
pMI2:244754..245485
Genome map
AA seq 243 aa AA seqDB search
MTIDHLSRRSAIATLGIGAAAMTINEASAQTPAAAPAAVPAFAGNHQVKPLRFNPARLHG
LSERLITSHHENNYAGSVKALNMIETRLAAALADTDLPPVVYGGLKREELHRTGSVVLHE
VYFDGLGGNGQAAGSIRDALGAAFGSFDRWEADFRRTGMSLAGGSGWCVLVYNLHTRSLH
NHWAWDHMHGAIAGVPLLALDMYEHSFHMDYGTAAAKYVDAFFRNIDWEVVDRRYAAALR
GGG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgaccatctttcccgacgcagtgcaatcgcaactcttggcatcggagccgcc
gccatgactatcaacgaagcctctgcgcagacgccggccgcagcgccggcggctgtcccc
gcctttgccggaaatcatcaggtcaagccgctcaggttcaatcccgccaggcttcacggc
ctctccgaaaggctgatcacatcgcaccacgagaacaattatgcgggctcggtcaaggcc
ctgaatatgatcgagacacgacttgccgccgcgctcgctgacacggacctgccgccggtg
gtctatggcggattgaagcgcgaggagctgcaccgcaccggctcggtcgtgctccatgag
gtctatttcgacgggctcggcggcaacggccaggcagccggttccatccgcgacgcgctg
ggcgcggcgttcggctcgttcgaccgctgggaagccgacttccgccgtaccgggatgagc
cttgccggcggatcgggctggtgcgtgctcgtctacaatctccacacgcgctcgctgcac
aaccattgggcgtgggatcatatgcacggtgcgattgccggcgtgccgctgctcgcgctc
gatatgtacgagcacagtttccacatggattacggcaccgccgccgccaaatatgtcgac
gccttcttccgcaacatcgactgggaagtggtcgaccggcgctatgccgcggctttgcgc
ggcggcggctga

DBGET integrated database retrieval system