KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1298Help
Entry
SP_1298           CDS       T00057                                 

Definition
(GenBank) DHH subfamily 1 protein
  KO
K06881  bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00920  Sulfur metabolism
spn01100  Metabolic pathways
spn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SP_1298
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spn03400]
    SP_1298
Enzymes [BR:spn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SP_1298
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     SP_1298
DNA repair and recombination proteins [BR:spn03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Others
    SP_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHH DHHA1
Motif
Other DBs
NCBI-ProteinID: AAK75402
UniProt: A0A0H2UQD4
LinkDB All DBs
Position
1229969..1230904
Genome map
AA seq 311 aa AA seqDB search
MEICQQILEKIKEYDTIIIHRHMKPDPDALGSQVGLKALLEHHFPEKTIKAVGFDEPTLT
WMAEMDLVEDRAYQGALVIVCDTANTARIDDKRYSQGDFLIKIDHHPNDDVYGDLSWVDT
SSSSASEMITLFAQTTQLALADRDAELLFAGIVGDTGRFLYPSTTARTLRLAAYLREHNF
DFAALTRKMDTMSYKIAKLQGYIYDHLEVDENGAARVILSQKILKQYNITDAETAAIVGA
PGRIDRVSLWGIFVEQADGHYRVRLRSKVHPINEIAKEHDGGGHPLASGANSYSLEENEI
IYQKLKNLLKN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagatttgccaacaaattttagaaaaaattaaagaatacgacaccattatcattcat
cgtcatatgaaaccagaccctgatgccttgggaagtcaggtgggattgaaagccttgctg
gaacatcatttcccagaaaaaaccatcaaagccgtcggttttgatgaaccaactcttact
tggatggctgagatggatcttgttgaagatagagcctaccaaggcgcacttgtcatcgtc
tgtgatacagctaatactgctcgtatcgatgataagcgctatagtcaaggtgattttctc
attaagattgaccaccatccaaatgatgatgtatacggtgacctgtcttgggtcgatact
agttcaagtagcgctagcgagatgattaccctatttgcccaaacaacccaactagccttg
gcagatcgcgatgctgagttgctctttgcaggaattgtcggtgatacaggtcgcttcctc
tacccttctaccactgcacggactcttcgcctggctgcttatttgagagaacataacttt
gactttgcggctctcactcgcaaaatggacactatgagctacaaaattgctaaactgcaa
ggctacatctacgaccatctggaagtggatgaaaatggtgctgctcgcgttatcctgagt
cagaaaatcttgaaacaatacaatataaccgatgctgaaactgcggccattgtaggtgca
cctggacgcattgacagagtgagtctctggggaatttttgtcgaacaggctgatggccac
taccgagttcgcttacgcagtaaagtccatcctatcaatgaaattgccaaggagcatgat
ggtggaggccaccctctagcaagtggtgctaattcctatagcctagaagaaaacgaaatc
atctaccaaaagttaaaaaacttgcttaaaaactga

DBGET integrated database retrieval system