KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1555
Entry
SP_1555           CDS       T00057                                 

Gene name
dapB
Definition
(GenBank) dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00261  Monobactam biosynthesis
spn00300  Lysine biosynthesis
spn01100  Metabolic pathways
spn01110  Biosynthesis of secondary metabolites
spn01120  Microbial metabolism in diverse environments
spn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SP_1555 (dapB)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SP_1555 (dapB)
Enzymes [BR:spn01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     SP_1555 (dapB)
SSDB
Motif
Pfam: DapB_C DapB_N GFO_IDH_MocA
Other DBs
NCBI-ProteinID: AAK75642
UniProt: P63895
LinkDB
Position
complement(1465696..1466463)
AA seq 255 aa
MSIRVIIAGFKGKMGQAACQMVLTDPDLDLVAVLDPFESESEWQGIPVFKDKADLAGFEA
DVWVDFTTPAVAYENTRFALENGFAPVVGTTGFTSEEIAELKEFSRAQDLGGLIAPNFAL
GAVLLMQFATQAAKYFPNVEIIELHHDKKKDAPSGTAIKTAELMAEVRESIQQGAADEEE
LIAGARGADFDGMRIHSVRLPGLVAHQEVIFGNQGEGLTLRHDSYDRISFMTGVNLGIKE
VVKRHELVYGLEHLL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagtattcgagtaattattgccggttttaagggaaagatgggccaggctgcttgtcag
atggtattgactgatccagacttggacttggtggcagttttggatccttttgagtctgag
tcagaatggcagggtattcctgttttcaaggataaggctgatttagctggttttgaagcg
gatgtctgggtagattttactactccagctgttgcctacgaaaatacacgttttgctctt
gaaaatggctttgctccagtagttggaacgactggtttcacgagtgaagaaattgcagag
ctaaaagaattttctcgtgcccaagacttgggtggcctgattgcccctaactttgccttg
ggtgctgtcttactcatgcaatttgcgacgcaggctgccaaatatttcccaaatgtggag
attattgagctccatcatgacaagaaaaaggatgctccgagtggaacagccattaaaaca
gctgagttgatggcagaggttcgagagtcaattcagcaaggtgcagcagatgaggaagag
ctgattgctggtgctcgtggtgctgactttgatggtatgcgcatccactcagttcgtttg
ccaggcttggtagctcatcaggaagtcatctttggcaatcagggagaagggttgaccctc
cgtcatgactcctatgatcgcatctccttcatgacaggagtcaatttgggaattaaagaa
gttgtcaagcgtcatgagcttgtctatggattagaacacttattatga

DBGET integrated database retrieval system