KEGG   Streptococcus pneumoniae TIGR4 (virulent serotype 4): SP_1994Help
Entry
SP_1994           CDS       T00057                                 

Definition
(GenBank) aminotransferase, class I
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spn  Streptococcus pneumoniae TIGR4 (virulent serotype 4)
Pathway
spn00220  Arginine biosynthesis
spn00250  Alanine, aspartate and glutamate metabolism
spn00290  Valine, leucine and isoleucine biosynthesis
spn01100  Metabolic pathways
spn01110  Biosynthesis of secondary metabolites
spn01130  Biosynthesis of antibiotics
spn01210  2-Oxocarboxylic acid metabolism
spn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SP_1994
   00290 Valine, leucine and isoleucine biosynthesis
    SP_1994
   00220 Arginine biosynthesis
    SP_1994
Enzymes [BR:spn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SP_1994
    2.6.1.66  valine---pyruvate transaminase
     SP_1994
Amino acid related enzymes [BR:spn01007]
 Aminotransferase (transaminase)
  Class I
   SP_1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AAK76061
UniProt: A0A0H2URS4
LinkDB All DBs
Position
complement(1896929..1898143)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDTDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gtattggaagaagccatgcggatgcgagcgaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggctttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggctattctgactccaaagggattttctcagcccgtaaggcc
atcatgcagtattgccagctgaagaaattcccaaacgtagatactgatgatatttacctt
ggaaatggtgtcagtgagttgattgtcatgtccatgcaggggcttttggacaatggggat
gaggtcttagtgccaatgccagactatcctctatggacggcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgtggaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaattgtccttatcaatccaaataaccca
actggagccctttatcctaaggaactcttgctggagattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatctatgaccgcatggtaatggacggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgtcagcatgaatggtctgtcaaaa
tcccaccgcatagcaggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtacaaacttccttggggggtcaccaatcagtcgatgaattgctt
cttcctggtggacgaatctacgagcaaagaaatttcatctataatgccattcaagatatt
ccaggtttgtctgccgttaaacccaaggcggggctctatatcttcccaaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgttgatgagttagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system