KEGG   Streptococcus pneumoniae SPN034156 (serotype 3): SPN034156_03250Help
Entry
SPN034156_03250   CDS       T02628                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
spne  Streptococcus pneumoniae SPN034156 (serotype 3)
Pathway
spne00627  Aminobenzoate degradation
spne01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spne00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SPN034156_03250
Enzymes [BR:spne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SPN034156_03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: CCP35994
LinkDB All DBs
Structure
PDB: 

Position
complement(336821..337594)
Genome map
AA seq 257 aa AA seqDB search
MKYKGYLIDLDGTIYKGKDRIPAGETFVHELQKRDIPYLFVTNNTTRTPESVKEMLAQNF
NIDTPLSTVYTATLATIDYMNDLGLEKTVYVVGEAGLKEAIKAAGYVEDKENPAYVVVGL
DWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGAGSLITLLEVATRVKPVYIG
KPNAIIMDKAVEHLGLEREELIMVGDNYLTDIRAGIDNGIPTLLVTTGFTKAEEVAGLPI
APTHVVSSLAEWDFDEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaggctatttaattgatttagacggaaccatttataaggggaaagaccga
atccctgctggagagacttttgttcatgaattgcaaaagcgggacattccctatctcttt
gtaaccaacaatacaacccgcactccagagagtgttaaggagatgttggctcagaatttt
aatatcgatacgcctctatcgactgtctacacagcgactttggcaaccatcgactatatg
aatgatttggggcttgaaaagactgtctatgtcgtcggagaagcaggactcaaggaagcc
atcaaggcggctggttatgtggaagacaaggaaaaccctgcctacgtggtagttggtctg
gattggcaagtcgactatgaaaaatttgccacagcaactcttgctattcaaaagggtgcc
cattttatcggaaccaatcctgacctcaacatcccgacggaacgtggtcttttgccaggt
gctggctcactgattacgctgcttgaagtagcgacacgagtgaagccggtttatatcgga
aaaccaaatgccatcattatggacaaggcggttgagcacttaggtttggaacgtgaagag
ttaatcatggttggggacaattatttgactgatatccgggctgggattgacaatggcatt
ccaacgctcttggtgacgacaggttttactaaggcagaagaagtggctggcctgccaatc
gcaccgacacatgtggtttctagccttgcggagtgggattttgatgaaaactaa

DBGET integrated database retrieval system