KEGG   Streptococcus pneumoniae gamPNI0373 (virulent serotype 1): HMPREF1038_01385Help
Entry
HMPREF1038_01385  CDS       T02334                                 

Gene name
pstB2
Definition
(GenBank) phosphate ABC transporter ATP-binding protein PstB2
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
spng  Streptococcus pneumoniae gamPNI0373 (virulent serotype 1)
Pathway
spng02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spng00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HMPREF1038_01385 (pstB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spng02000]
    HMPREF1038_01385 (pstB2)
Enzymes [BR:spng01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     HMPREF1038_01385 (pstB2)
Transporters [BR:spng02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    HMPREF1038_01385 (pstB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 AAA_22 AAA_29 RsgA_GTPase AAA_23 AAA_33 AAA_18 AAA_30 AAA_16 Pox_A32 cobW AAA_7 AAA_28 Adeno_IVa2 ATP_bind_1 MMR_HSR1 Cytidylate_kin G-alpha Rad17
Motif
Other DBs
NCBI-ProteinID: AFS43417
LinkDB All DBs
Position
complement(1281672..1282475)
Genome map
AA seq 267 aa AA seqDB search
MSTYNWDEKHILTFPEEKVALSTKDVHVYYGKNESIKGIDMQFERNKITALIGPSGSGKS
TYLRSLNRMNDTIDIAKVTGQILYRGIDVNRPEINVYEMRKHIGMVFQRPNPFAKSIYRN
ITFAHERAGVKDKQVLDEIVETSLRQAALWDQVKDDLHKSALTLSGGQQQRLCIARAISV
KPDILLMDEPASALDPIATMQLEETMFELKKNFTIIIVTHNMQQAARASDYTGFFYLGDL
IEYDKTATIFQNAKLQSTNDYVSGHFG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatataactgggatgagaagcatatccttacctttcctgaagaaaaagtagcc
ctttctactaaggatgtccatgtttactatggtaaaaatgaatccattaaggggattgat
atgcaatttgaaagaaataaaattacagctttgattggtccgtcgggatcggggaaatct
acctacttacgcagtctcaatcgcatgaatgataccattgatattgctaaagtaactggg
cagattctctatcgtggaattgatgtcaaccgtccagaaatcaacgtttatgaaatgcgt
aaacacattggaatggtttttcaacgccccaatccatttgctaagtcaatttaccgtaat
attacctttgcgcatgaacgtgctggagttaaggataagcaagtcctagatgaaatcgta
gaaacctcccttcgtcaggctgccctctgggatcaggttaaagacgatctccacaagtca
gccttgaccttatcaggtggtcagcaacaacgtctctgtatcgctcgtgccatctctgtt
aagccagatatcctcttaatggatgagccagcctcagccttggatccgattgcgaccatg
caactagaagagaccatgtttgagctcaagaaaaactttaccatcatcattgtaacgcat
aatatgcagcaggctgctcgtgcaagtgactatacaggcttcttttacttgggtgatttg
attgagtatgacaagactgcaactattttccaaaatgccaagctacagtccaccaatgac
tatgtatctggtcactttggttag

DBGET integrated database retrieval system