KEGG   Streptococcus pneumoniae SPN994038 (serotype 3): SPN994038_08900Help
Entry
SPN994038_08900   CDS       T02630                                 

Definition
(GenBank) putative amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
spnm  Streptococcus pneumoniae SPN994038 (serotype 3)
Brite
KEGG Orthology (KO) [BR:spnm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SPN994038_08900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: CCP30626
LinkDB All DBs
Position
897210..898601
Genome map
AA seq 463 aa AA seqDB search
MNIFRTKNVSLDKTEMHRHLKLWDLILLGIGAMVGTGVFTITGTAAATLAGPALVISIVI
SALCVGLSALFFAEFASRVPATGGAYSYLYAILGEFPAWLAGWLTMMEFMTAISGVASGW
AAYFKGLLSQYGIAFPQALNGTFNPQAGTFVDLLPILVLVLVTSLVLLNAKAALRFNSIL
VILKFSALALFVLVGIWNIKFDNWSNFAPYGFGQIYGASTGIMAGASLMFFGFLGFESIS
MAVDEVKTPQKNIPRGIVLSLSIVTILYALVTLVLTGVVHYSHLNVDDAVAFALRSVGIS
WAANYVSLVAILTLITVCISMTYALSRMIYSLARDGLVPAAFKELTKTSKIPKNATILTG
LASAVAAGMFPLASIAAFLNICTLAYLILLAYGLIRLRKEKGMPKAGEFKTPLVPLLPIL
SIIICLSFMLQYNMNTWIAFLVALLVGSIIYFTYGYKHSTIEE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatttagaacaaagaatgttagtttagataaaacagagatgcataggcatttg
aagttatgggatttgattttgctgggtatcggagccatggtagggacaggcgtctttaca
atcacaggtactgcagctgcaacacttgctggcccagccctagtgatttcaatcgttatt
tctgccttgtgtgtgggattatcagccctcttttttgcagaatttgcctcgcgagtaccc
gctacaggaggtgcctatagttacctctatgctatcttaggagaattccctgcctggttg
gctggttggttaaccatgatggagttcatgacagccatatcaggcgtagcttcgggttgg
gcagcttattttaaaggcttgctctctcaatacgggatagcctttcctcaggctttaaat
ggtacctttaatcctcaagcagggacatttgttgatttattgcctattcttgtcttggtc
ttggtgacttcgcttgttttactaaatgccaaggcagccttacgctttaattcgattcta
gttattttgaaattttccgctttagctctctttgttttagtaggaatttggaatattaag
tttgataattggagcaattttgctccttacggttttggacaaatctatggagctagcact
ggtattatggctggtgcgtccttgatgttcttcggttttttgggatttgaatccatctct
atggctgtagatgaagtcaagactcctcaaaaaaatattcctagagggattgtcttatcg
ctttctatcgtaaccattctctatgccttggtgacccttgttttgactggtgtggttcac
tatagtcatttaaatgtcgatgatgccgttgcctttgcccttcgtagtgttgggattagt
tgggcagccaactatgtgtcattagtggctatcttgaccttgattacagtttgtatttcg
atgacctatgccctatcgcgtatgatttacagtttagcacgtgacggcttagtgcctgct
gcctttaaggaactgacgaagactagcaagataccaaagaatgctactatcttgacaggt
ctagcttcagcagtagcagcaggaatgttcccactagccagtattgcagcctttttaaat
atttgtaccttagcctacttgatcctgctggcttatggtctgattcgcttacggaaagaa
aaaggaatgcccaaagctggggaatttaaaacaccattggtacctctgttaccaatttta
tcgatcatcatttgtttatccttcatgttacagtataatatgaatacctggattgctttc
ctagttgcgttgttagtaggaagtattatttacttcacttatggctataagcattctacc
atagaagaataa

DBGET integrated database retrieval system