KEGG   Streptococcus pneumoniae SPN994038: SPN994038_09430Help
Entry
SPN994038_09430   CDS       T02630                                 

Definition
(GenBank) D-Ala D-Ala ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spnm  Streptococcus pneumoniae SPN994038
Pathway
spnm00473  D-Alanine metabolism
spnm00550  Peptidoglycan biosynthesis
spnm01100  Metabolic pathways
spnm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spnm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPN994038_09430
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPN994038_09430
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SPN994038_09430
Enzymes [BR:spnm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPN994038_09430
Peptidoglycan biosynthesis and degradation proteins [BR:spnm01011]
 Precursor biosynthesis
  Amino acid ligase
   SPN994038_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 RimK ATPgrasp_YheCD ATP-grasp TTL Peptidase_C23
Motif
Other DBs
NCBI-ProteinID: CCP30679
LinkDB All DBs
Position
947749..948714
Genome map
AA seq 321 aa AA seqDB search
MAIIKKIVVLYGGLSEEREVSENSAKEISKSLLTLGYDVISIDLSQDCSYEIGEIEKSER
GLNKQKVEIGSGIIDVCRKVDIVFLATHGGIGENGKLQAIFDVEKIDYTGNSFLSTAISM
DKKLSKIVASSVGIKCASNLMVDRIQANDFPIVIKPIRSGSSKGIKIFQNKKQFDIYYKE
HPELGSVFVEKYIKGREFSVGILGETVLPVIEIKVKNGFYDYNNKYTVGAAEEVVPAKIS
EKLTHTLQKSAYKIHKALGFNVYSRTDFIVDEKGDVYFIESNSLPGMTKTSLLPQEAKAA
GIDFPNLCERIIELSREIRSQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctattattaaaaaaattgttgtactatatggtggccttagcgaagagagggaggtg
tcagaaaattctgcaaaggaaattagtaaaagtctattaacattggggtatgatgtgatt
tctatagatttatctcaagactgttcgtacgagataggagaaattgaaaaaagtgagcgc
ggattaaataaacaaaaagttgagattggttcgggtattattgatgtttgtagaaaggtt
gatatagttttcttagcaactcatggtggaataggtgagaatgggaaactacaggctatt
tttgatgtagaaaaaatagactatacaggaaattcgtttcttagtacagctattagcatg
gataaaaaattatcaaaaatagtggctagttctgttggaataaaatgtgcttcgaacttg
atggttgatagaattcaggcaaatgattttcctattgttataaagccaattagaagtggt
tcaagtaaaggtattaagatatttcaaaataaaaaacaatttgacatttattataaagag
catcctgaacttggttcagtctttgtagaaaagtatattaaggggagagaattttcggta
ggtattttaggtgaaactgttttaccggttattgaaataaaagtaaaaaatggtttttat
gattataataacaagtacactgttggtgcagctgaagaagtcgttcccgcaaaaatatct
gaaaagttaactcataccttacaaaaatccgcatataaaatacataaggctcttggattt
aatgtttattcacgtactgattttattgtagatgagaagggggatgtatattttattgaa
tcaaatagtttaccaggtatgactaaaacaagtttattaccacaggaagcgaaagcagct
ggtatagatttcccaaacctatgtgaacgtattattgagctgagtagggaaattagatct
caatag

DBGET integrated database retrieval system